DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rhp and rhpn1

Sequence 1:NP_511168.3 Gene:Rhp FlyBaseID:FBgn0026374 Length:718 Species:Drosophila melanogaster
Sequence 2:XP_003200825.2 Gene:rhpn1 ZFINID:ZDB-GENE-081031-79 Length:659 Species:Danio rerio

Alignment Length:703 Identity:274/704 (39%)
Similarity:390/704 (55%) Gaps:105/704 (15%)


  Fly    33 RGSDPRAATCRSKLQNRRCKLNKEINKELRLRAGAENLYKATSNRKLRDTVALELSFVNSNLQLL 97
            :|.||..:|.|||||.||.|||::||:||.||:||||||:|::|:|:::||||||||||||||||
Zfish    23 KGCDPLVSTQRSKLQQRRAKLNQQINRELLLRSGAENLYRASTNQKVKETVALELSFVNSNLQLL 87

  Fly    98 KEQLAELNSSVEIYQSESHNGIMPMIPLGLKETKEINFMEPFSDFILEHYSEEPSMYIDAIADMT 162
            ||:|.|||||:.|||:||....:|||||||||||||:...|..|||.|||.|:.|:|::.|.|..
Zfish    88 KEELEELNSSMNIYQTESETLNVPMIPLGLKETKEIDMTVPLQDFIAEHYGEDASLYLNEIQDFM 152

  Fly   163 DTRQASKTPSRDALGVALLFRYYNTLYYVERRFFPPDRNLGVYFEWYDSLTGVPSCQRTIAFEKA 227
            :.|||.:||||:..|..||..|:|.||::::|||.|.|:|||:|.||||||||||.||.:||||.
Zfish   153 ELRQAMRTPSRNEAGQELLMEYFNQLYFLDQRFFSPHRSLGVHFHWYDSLTGVPSVQRALAFEKG 217

  Fly   228 CTLFNLGGIYTQIGARHDRTTERGLDLAVDSFLRAAGVFRHIYDTFTNAPSMDLKPQVLDVLVSL 292
            ..|||:|.:|||||||.||:|..|::.|:|:|.||||.|.::.:.|::|||:|:....|.:||.|
Zfish   218 SVLFNIGALYTQIGARQDRSTLSGIEDAIDAFQRAAGAFLYLQENFSHAPSLDMSGSALSMLVRL 282

  Fly   293 MLSQARECLFEKLQLQIEAMSHDCQAFRDLAGEAAQISHEYNEMHKNIQANDTHTYLPECWAGLV 357
            |::|.:||:.||:.|.|:.:  ........|.|||::|..|:.:.:.:.......|:|..|..:|
Zfish   283 MVAQVQECVCEKVLLNIQDI--HLNVLLQAAQEAARVSDVYSLVLQAMSVPLLKDYVPFSWISMV 345

  Fly   358 PVKAELYKAFAHFYKARSI-DATDELKASKSSQKNQESFIGNSQEVERITTADYGASDEASTSIA 421
            .||...::|.||:|.|.:: |.               |.:|:..|    ..|:..|..:..|...
Zfish   346 QVKTHHFRALAHYYTAVALCDC---------------SGVGDEDE----DGAEIKALVQIHTRQP 391

  Fly   422 NKL-------------AHLKEALASIEEAQRLQRMCRFLKNKASLTEVMKEVHSKSQEELEKFRL 473
            .||             |||::|:...|||.||..:|:.|:....|.||:.:.|::|   |||:  
Zfish   392 EKLNLQDPEDKRRLGKAHLRKAIIRHEEALRLHGVCKMLRKMDILQEVLSDAHTRS---LEKY-- 451

  Fly   474 QASAKNIEDGDLLE----RSVEASSKFTLSLTGPDFTSHKVKDPFKRLGPIAIFSARRHWTAPRC 534
              |..:.|| |..|    ..|::.::....:..|||:..:|.|.|.||||:::||||..||. |.
Zfish   452 --SDIDQED-DFCEVAEAPEVQSHTQQKPDIKAPDFSVVRVTDIFHRLGPLSVFSARNRWTR-RH 512

  Fly   535 VRLQKGSSLYHSVPSNDNKCPLDNDDDEEHDGGYNLYKEEFENFGFHVRGDAPVIIAHVEINSLA 599
            |.|.:|.:                                  ..|..:|||:||::|.|.....|
Zfish   513 VCLVRGEA----------------------------------GLGLTLRGDSPVLVAGVLPGGCA 543

  Fly   600 DLGGIKEGDFIVEIAGVDVKWYSHQQVVQLIQSCGST-LELRVITPMDRNYLKPLSSKGSLSTLS 663
            ..||::|||:||.:..||.:|..|.:||..::||... |||.:||.......:.::       ||
Zfish   544 AEGGLREGDYIVAVNSVDCRWAEHAEVVHALKSCPDRGLELDIITLQTHEVERRMN-------LS 601

  Fly   664 AASSSGISSGFPSPTSIAAKPKLHLKTSSSSRPAGSVSSSSWNPFRRTPSLAK 716
            .:......||               ....:.|..|..|||.|....|...::|
Zfish   602 PSGEQDYQSG---------------SQRRAGREYGGSSSSVWGWSWRNSGVSK 639

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RhpNP_511168.3 HR1_Rhophilin-1 34..118 CDD:212023 58/84 (69%)
BRO1_Rhophilin 122..514 CDD:185767 159/410 (39%)
PDZ_signaling 570..642 CDD:238492 27/73 (37%)
rhpn1XP_003200825.2 HR1 24..107 CDD:294066 58/83 (70%)
BRO1_Alix_like 112..493 CDD:301330 159/410 (39%)
PDZ_signaling 511..580 CDD:238492 28/103 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C284686616
eggNOG 1 0.900 E1_KOG2220
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D286986at33208
OrthoFinder 1 1.000 FOG0002677
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132236
Panther 1 1.100 LDO PTHR23031
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.