DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rhp and brox

Sequence 1:NP_511168.3 Gene:Rhp FlyBaseID:FBgn0026374 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_001096412.1 Gene:brox XenbaseID:XB-GENE-5745545 Length:411 Species:Xenopus tropicalis

Alignment Length:316 Identity:71/317 (22%)
Similarity:125/317 (39%) Gaps:59/317 (19%)


  Fly   127 LKETKEINFMEPFSDFILEH--YSEEPSMYIDAIADMTDTRQASKTPSRDALGVALLFRYYNTLY 189
            |:.|: ...:|.|||....|  .......|...:....|:....   ::|           |.|.
 Frog    36 LRSTR-ARLLELFSDITCNHEMMKNATDAYFSLLLGFIDSLDGG---TQD-----------NKLR 85

  Fly   190 YVERRFFPPDRNLGVYFEWYDSLTG-VPSCQRTIAFEKACTLFNLGGIYTQIGAR----HDRTTE 249
            |::.            |:|.|:|.| .||.|:...||.....||:...||:..:|    .|.|.|
 Frog    86 YIQN------------FKWTDTLQGNAPSAQQDAVFELVSMGFNVALWYTKYASRLAGKEDITEE 138

  Fly   250 RGLDLAVDSFLRAAGVFRHIYDTFTNAPSM--------DLKPQVLDVLVSLMLSQARECLFEKLQ 306
            ...::. .|...|||||:|:.:  .:.|.:        ||:.:|:|.......::|:|....:  
 Frog   139 EAKEVH-RSLKIAAGVFKHLKE--NHIPKLITPVEKGRDLETRVIDAYTVQCQAEAQEVTIAR-- 198

  Fly   307 LQIEAMSHDCQAFRDLAGEAAQISHEYNEMHKNIQANDTHTYLPECWAGLVPVKAELYKAFAHFY 371
             .|| :.|:......||.|.|   :.|.::...:...|. .|:.: |.....:|...|.|:::.|
 Frog   199 -AIE-LKHNPGLIAALAYETA---NYYQKVDHTLATLDP-VYIAK-WRSYTQLKMCFYMAYSYCY 256

  Fly   372 KARSIDATDELKASKSSQKNQESFIGNSQEVERITTADYGASDEASTSIANKLAHL 427
            ..:::.:.|:...:..|.:..|.|.|.::.:    ..:||.:....|: |....||
 Frog   257 HGQTLLSADKCGEAIRSLQEAEKFYGKAEAL----CKEYGETKGPGTT-AKPSGHL 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RhpNP_511168.3 HR1_Rhophilin-1 34..118 CDD:212023
BRO1_Rhophilin 122..514 CDD:185767 71/317 (22%)
PDZ_signaling 570..642 CDD:238492
broxNP_001096412.1 BRO1_Brox_like 4..356 CDD:185766 71/317 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.