DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rhp and ptpn23a

Sequence 1:NP_511168.3 Gene:Rhp FlyBaseID:FBgn0026374 Length:718 Species:Drosophila melanogaster
Sequence 2:XP_005158252.1 Gene:ptpn23a ZFINID:ZDB-GENE-100921-24 Length:2003 Species:Danio rerio

Alignment Length:470 Identity:117/471 (25%)
Similarity:204/471 (43%) Gaps:116/471 (25%)


  Fly   120 MPMIPLGLKETKEINFMEPFSDFILEHYSEEPSMYIDAIADMTDTRQASKTPSRDALGVALLFRY 184
            ||||.|.|||..|..|......|||::|.|:|..|.:.:..:...||::...:||..|.:.|.:|
Zfish     7 MPMIWLDLKEAGEFQFSPTVKQFILKNYGEDPDNYNEQLKKLEQLRQSAVNVTRDFEGCSTLRKY 71

  Fly   185 YNTLYYVERRFFPP---DRNLGVYFEWYDSLTGVPSCQRTIAFEKACTLFNLGGIYTQIGARHDR 246
            :..|:|::.|.  |   .:...|...|.:..:|.......|.:|:||.|:|||.:::.:||..:|
Zfish    72 FGQLHYLQSRV--PLGLGQEAAVPISWTEIFSGKTVTHEDICYEQACILYNLGALHSMLGAMDNR 134

  Fly   247 TTERGLDLAVDSFLRAAGVFRHIYDTFTNAPSMDLKPQVLDVLVSLMLSQARECLFEKLQLQIEA 311
            .:|.|:.::...|..:||.|.::.|.|:::.|:|:..|:|::.::|||.||:|||.||      :
Zfish   135 VSEEGMKVSCTHFQCSAGAFAYLRDHFSHSYSVDMSHQILNLNINLMLGQAQECLLEK------S 193

  Fly   312 MSHDCQAFRDLAGEAAQISHEYNEMHKNIQANDTHTYLPEC---WAGLVPVKAELYKAFAHFYKA 373
            |..:.::|. :|..:||:...|.|..:.::.::|.:.|.:.   |..||.:|...:.|.||    
Zfish   194 MLDNRKSFL-VARISAQVVDYYKEACRALENSETASMLGKIQKDWKKLVQMKIYYFAAIAH---- 253

  Fly   374 RSIDATDELKASKSSQKNQESFIGNSQEVERITTADYGASDEASTSIANKLAHLKEALASIEEAQ 438
                    |...|.:::.|:                ||          .::|:|:.:|..:.||.
Zfish   254 --------LHMGKQAEEQQK----------------YG----------ERVAYLQSSLDKLGEAI 284

  Fly   439 RLQRMCRFLKNKASLTEVMKEVHSKSQEELEKFRLQASAKNIEDGDLLERSVEASSKFTLSLTGP 503
            :|                     :|.|.:                     ||:.:.:||:.:.|.
Zfish   285 KL---------------------AKGQPD---------------------SVQEALRFTMDVIGG 307

  Fly   504 DFTSHKVKDPFKRLGPIAIFSARRHWTAPRCVRLQ--KGSSLYHSVPSNDNKCPLDNDD------ 560
            .|.|.|..:.|       |:    |.:.|....|.  ||:.|..::|.|.....:...|      
Zfish   308 KFNSAKKDNDF-------IY----HESVPSLETLTSVKGAPLVKALPVNPTDPSVTGPDIFAKLV 361

  Fly   561 -DEEHDGGYNLYKEE 574
             ...|:.. :||.||
Zfish   362 PMAAHEAS-SLYSEE 375

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RhpNP_511168.3 HR1_Rhophilin-1 34..118 CDD:212023
BRO1_Rhophilin 122..514 CDD:185767 99/398 (25%)
PDZ_signaling 570..642 CDD:238492 4/6 (67%)
ptpn23aXP_005158252.1 BRO1_HD-PTP_like 2..357 CDD:185762 112/450 (25%)
V_HD-PTP_like 362..698 CDD:185747 5/16 (31%)
ALIX_LYPXL_bnd 416..701 CDD:290660
Y_phosphatase 1548..1780 CDD:278528
PTPc 1549..1779 CDD:238006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2220
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.