DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Paf-AHalpha and PAFAH1B2

Sequence 1:NP_525089.2 Gene:Paf-AHalpha FlyBaseID:FBgn0025809 Length:225 Species:Drosophila melanogaster
Sequence 2:XP_016873329.1 Gene:PAFAH1B2 HGNCID:8575 Length:242 Species:Homo sapiens

Alignment Length:221 Identity:106/222 (48%)
Similarity:148/222 (67%) Gaps:0/222 (0%)


  Fly     2 NPCVLPTPLPDLDGDKRWHSIHRRFISDCREKDPDVIFLGDCIFETVQDTEAWNKYFAPLHCLNF 66
            ||..:|....|:.||.||.|.|.||:.||::|:|||:|:||.:.:.:|..|.|.:.|:|||.|||
Human    20 NPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNF 84

  Fly    67 SIRDDCTEHVLWRIENGALDNVNPKIVVLHVGTNNVRNSAEEVAEGVLANVTKIRQKLPNAYIVL 131
            .|..|.|.|||||::||.|:|:.||::|:.|||||..|:|||||.|:.|.|..|..:.|.|.|::
Human    85 GIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIV 149

  Fly   132 PSLLPRGQQPNKLREKNAKINEVVNGLTKGLYRVQTVAIDKGLVQTDGSISHHDMFDYKNLTNAG 196
            ..|||||::||.||:||||:|:::......|..||.:..|.|.|.:||:||.|||||:.:||..|
Human   150 LGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGG 214

  Fly   197 AKKILEPLYDLLSQILNENEPENDLT 222
            ..||.:||::|:.|:|.|...|...|
Human   215 YAKICKPLHELIMQLLEETPEEKQTT 240

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Paf-AHalphaNP_525089.2 PAF_acetylesterase_like 3..212 CDD:238858 101/209 (48%)
PAFAH1B2XP_016873329.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43437054
eggNOG 1 0.900 E1_KOG1388
Hieranoid 1 1.000
Homologene 1 1.000 H1932
Inparanoid 1 1.050 228 1.000 Inparanoid score I3413
Isobase 1 0.950 0 Normalized mean entropy S5447
OMA 1 1.010
OrthoDB 1 1.010 D1604899at2759
OrthoFinder 1 1.000 FOG0002845
OrthoInspector 1 1.000 T610193
orthoMCL 1 0.900 OOG5_131496
Panther 1 1.100 O PTHR11852
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4710
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.