DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Paf-AHalpha and Pafah1b3

Sequence 1:NP_525089.2 Gene:Paf-AHalpha FlyBaseID:FBgn0025809 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001344279.1 Gene:Pafah1b3 MGIID:108414 Length:232 Species:Mus musculus

Alignment Length:215 Identity:98/216 (45%)
Similarity:144/216 (67%) Gaps:0/216 (0%)


  Fly     2 NPCVLPTPLPDLDGDKRWHSIHRRFISDCREKDPDVIFLGDCIFETVQDTEAWNKYFAPLHCLNF 66
            ||...|||:.|:.||.||.|:|.||::|.::|:|:|:|:||.:.:.:...|.|.:.|:|||.|||
Mouse     7 NPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNF 71

  Fly    67 SIRDDCTEHVLWRIENGALDNVNPKIVVLHVGTNNVRNSAEEVAEGVLANVTKIRQKLPNAYIVL 131
            .|..|.|:|||||:|||.|:::.|||||:.|||||..::||:|..|:.|.|..:.:..|.|.:|:
Mouse    72 GIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHSHTAEQVTGGIKAIVQLVNKLQPQARVVV 136

  Fly   132 PSLLPRGQQPNKLREKNAKINEVVNGLTKGLYRVQTVAIDKGLVQTDGSISHHDMFDYKNLTNAG 196
            ..||||||.||.|||||.::||:|.....|..|...:..|.|.|.:||:||||||:||.:|:..|
Mouse   137 LGLLPRGQHPNPLREKNRQVNELVRAALAGYPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLG 201

  Fly   197 AKKILEPLYDLLSQILNENE 216
            ...:...|:.||.::|.:::
Mouse   202 YTPVCRALHSLLLRLLAQDQ 221

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Paf-AHalphaNP_525089.2 PAF_acetylesterase_like 3..212 CDD:238858 96/209 (46%)
Pafah1b3NP_001344279.1 PAF_acetylesterase_like 8..206 CDD:238858 93/198 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43438105
eggNOG 1 0.900 E1_KOG1388
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 230 1.000 Inparanoid score I3417
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002845
OrthoInspector 1 1.000 T616998
orthoMCL 1 0.900 OOG5_131496
Panther 1 1.100 LDO PTHR11852
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1110.760

Return to query results.
Submit another query.