DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL3 and RPL3

DIOPT Version :8

Sequence 1:NP_511166.2 Gene:mRpL3 / 32523 FlyBaseID:FBgn0030686 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_014706.1 Gene:RPL3 / 854229 SGDID:S000005589 Length:387 Species:Saccharomyces cerevisiae

Alignment Length:338 Identity:81/339 (24%)
Similarity:124/339 (37%) Gaps:78/339 (23%)


  Fly    16 GNSSVLVTQVRDKGHLSRPRLRNPQWFLRKEITKYNDLMTAENKQFVNEVGTNNFGVPAVIKDSL 80
            |..:.:.|.|||   |.||..:    |.::|:.           :.|..|.|....|..|:  ..
Yeast    48 GYKAGMTTIVRD---LDRPGSK----FHKREVV-----------EAVTVVDTPPVVVVGVV--GY 92

  Fly    81 VKT-AGPTANEAVWTPNLRRCGVIARKIGQYPLWLKNGERIRTTLLQIVDNHVIKYIPPEEYLPA 144
            |:| .|..:...||..:|  ...:.|:.  |..|.|:.::..|       .:..||......:..
Yeast    93 VETPRGLRSLTTVWAEHL--SDEVKRRF--YKNWYKSKKKAFT-------KYSAKYAQDGAGIER 146

  Fly   145 QVPTVANLHKRGCILVGSETTNPALLTKE--YAGIFRNSGVLPKK-NLAR--FIVSPEAQLAPGT 204
            ::..:........:||.::.....|..|:  .|.|..|.|.:.:| :.||  |    |..:|..:
Yeast   147 ELARIKKYASVVRVLVHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHF----EKTVAVDS 207

  Fly   205 PLNVNHFRVGDFVDVRGKTVDHGFQGVVKRHGFKGMPASHGVTKTHRRAGNIGGGGEKGRVWPGT 269
            .     |...:.:|....|..|||:||..|.|.|.:|     .||||....:...|    .|   
Yeast   208 V-----FEQNEMIDAIAVTKGHGFEGVTHRWGTKKLP-----RKTHRGLRKVACIG----AW--- 255

  Fly   270 KMPGHMGNRWRIIK-GLRVWRINTKYN--VMWV-QGSSVA-GPTGGLVYIYDTILPTRKNKEAPP 329
             .|.|:  .|.:.: |.|.:...|..|  :..| :|...| |.|.     :|     |..|...|
Yeast   256 -HPAHV--MWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATS-----FD-----RTKKTITP 307

  Fly   330 FPTF--YGEPQQD 340
            ...|  |||.:.|
Yeast   308 MGGFVHYGEIKND 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL3NP_511166.2 RplC 101..314 CDD:294230 51/223 (23%)
RPL3NP_014706.1 Ribosomal_L3 1..387 CDD:320904 81/339 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.