DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL3 and Rpl3l

DIOPT Version :10

Sequence 1:NP_511166.2 Gene:mRpL3 / 32523 FlyBaseID:FBgn0030686 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001157417.1 Gene:Rpl3l / 66211 MGIID:1913461 Length:407 Species:Mus musculus


Alignment Length:179 Identity:39/179 - (21%)
Similarity:60/179 - (33%) Gaps:53/179 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 NSGVLPKKNLARFIVSPEAQLAPGTPLNVNHFRVGDFVDVRGKTVDHGFQGVVKRHGFKGMPASH 244
            |.|.:.:|     :...:|::....|:: :.|...:.:||...|...|.:||..|...|.:|   
Mouse   186 NGGTVAEK-----VAWVQARMEKQVPVH-SVFSQSEVIDVIAVTKGRGVKGVTSRWHTKKLP--- 241

  Fly   245 GVTKTHRRAGNIG--GGGEKGRVWPGTKMPGHMGNRWRIIKGLRVWRI----------------N 291
              .|||:....:.  |.....||.......|..|...|.....:::||                :
Mouse   242 --RKTHKGLRKVACIGAWHPARVGCSIARAGQKGYHHRTELNKKIYRIGRGLHMEDGKMVRNNAS 304

  Fly   292 TKYNVMWVQGSSVAGPTGGLVYIYDTILPTRKNKEAPPFPTFYGEPQQD 340
            |.|:   |...|:. |.||                   || .|||...|
Mouse   305 TSYD---VTDKSIT-PLGG-------------------FP-HYGEVNND 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL3NP_511166.2 rpl3p 101..314 CDD:444836 33/151 (22%)
Rpl3lNP_001157417.1 PTZ00103 1..400 CDD:240267 39/179 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.