DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL3 and RPL3L

DIOPT Version :8

Sequence 1:NP_511166.2 Gene:mRpL3 / 32523 FlyBaseID:FBgn0030686 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_011520873.1 Gene:RPL3L / 6123 HGNCID:10351 Length:412 Species:Homo sapiens

Alignment Length:179 Identity:40/180 (22%)
Similarity:60/180 (33%) Gaps:53/180 (29%)


  Fly   180 NSGVLPKKNLARFIVSPEAQLAPGTPLNVNHFRVGDFVDVRGKTVDHGFQGVVKRHGFKGMPASH 244
            |.|.:.:|     :...:|:|....|:: :.|...:.:||...|...|.:||..|...|.:|   
Human   191 NGGTVAEK-----VAWAQARLEKQVPVH-SVFSQSEVIDVIAVTKGRGVKGVTSRWHTKKLP--- 246

  Fly   245 GVTKTHRRAGNIG--GGGEKGRVWPGTKMPGHMGNRWRIIKGLRVWRI----------------N 291
              .|||:....:.  |.....||.......|..|...|.....:::||                :
Human   247 --RKTHKGLRKVACIGAWHPARVGCSIARAGQKGYHHRTELNKKIFRIGRGPHMEDGKLVKNNAS 309

  Fly   292 TKYNVMWVQGSSVAGPTGGLVYIYDTILPTRKNKEAPPFPTFYGEPQQD 340
            |.|:   |...|:. |.||                   || .|||...|
Human   310 TSYD---VTAKSIT-PLGG-------------------FP-HYGEVNND 334

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL3NP_511166.2 RplC 101..314 CDD:294230 34/152 (22%)
RPL3LXP_011520873.1 PTZ00103 6..403 CDD:240267 40/180 (22%)
RplC 12..378 CDD:294230 40/180 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.