DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mvd and MVD1

Sequence 1:NP_001285295.1 Gene:Mvd FlyBaseID:FBgn0030683 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_014441.1 Gene:MVD1 SGDID:S000005326 Length:396 Species:Saccharomyces cerevisiae

Alignment Length:410 Identity:183/411 (45%)
Similarity:248/411 (60%) Gaps:42/411 (10%)


  Fly     1 MFSVTCVAPVNIALIKYWGKRHEELILPVNDSISMTLSTDELCAKTTVTASESFETNRMWLNGEE 65
            :::.:..||||||.:||||||..:|.||.|.|||:|||.|:|...|:...:..||.:.:||||| 
Yeast     3 VYTASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLSQDDLRTLTSAATAPEFERDTLWLNGE- 66

  Fly    66 VPFE-ESSRLQRCLNEVHRLAVASGSQKVP-PT---WKLHIASVNNFPTAAGLASSAAGYACLVY 125
             |.. ::.|.|.||.::.:|.....|:... ||   |||||.|.|||||||||||||||:|.||.
Yeast    67 -PHSIDNERTQNCLRDLRQLRKEMESKDASLPTLSQWKLHIVSENNFPTAAGLASSAAGFAALVS 130

  Fly   126 SLSRLYDIPLN-EELTTVARQGSGSACRSLYGGFVQWHRGALDDGSDSVARQIAPSDHWPNMHVL 189
            ::::||.:|.: .|::.:||:|||||||||:||:|.|..|..:||.||:|.|||.|..||.|...
Yeast   131 AIAKLYQLPQSTSEISRIARKGSGSACRSLFGGYVAWEMGKAEDGHDSMAVQIADSSDWPQMKAC 195

  Fly   190 ILVVNDARKKTASTRGMQQAVKTSQLIKHRVDQVVPDRIIRLREAIASHDFQAFAEITMKDSNQF 254
            :|||:|.:|..:||:|||..|.||:|.|.|::.|||.|...:|:||...||..||:.||.|||.|
Yeast   196 VLVVSDIKKDVSSTQGMQLTVATSELFKERIEHVVPKRFEVMRKAIVEKDFATFAKETMMDSNSF 260

  Fly   255 HAIALDTYPPCVYMNDVSHSIVSFVHDYNERMGSYHAAYTFDAGPNACLYVLAEHVPHLLSAIQK 319
            ||..||::||..||||.|..|:|:.|..|:..|....||||||||||.||.|||:...|.:.|.|
Yeast   261 HATCLDSFPPIFYMNDTSKRIISWCHTINQFYGETIVAYTFDAGPNAVLYYLAENESKLFAFIYK 325

  Fly   320 VFPNDLADGGTYLRGLPIP--------KVQDAESSKLDS-------LDVHAKNAFRYIIHTKVGE 369
            :|.:             :|        :..:|.:.:.:|       ||:..:.....:|.|:||.
Yeast   326 LFGS-------------VPGWDKKFTTEQLEAFNHQFESSNFTARELDLELQKDVARVILTQVGS 377

  Fly   370 GPKELSADNSLLIN---GLP 386
            ||:|   .|..||:   |||
Yeast   378 GPQE---TNESLIDAKTGLP 394

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MvdNP_001285295.1 PLN02407 1..322 CDD:178029 165/327 (50%)
GHMP_kinases_C 231..323 CDD:285715 48/92 (52%)
MVD1NP_014441.1 mevDPdecarb 6..328 CDD:130307 165/324 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C213032618
eggNOG 1 0.900 E1_COG3407
Hieranoid 1 1.000
Homologene 1 1.000 H1843
Inparanoid 1 1.050 320 1.000 Inparanoid score I446
Isobase 1 0.950 0 Normalized mean entropy S814
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004240
OrthoInspector 1 1.000 T1136784
orthoMCL 1 0.900 OOG5_128252
Panther 1 1.100 LDO PTHR10977
Phylome 1 0.910 0.982 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R783
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.