DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mvd and AT3G54250

Sequence 1:NP_001285295.1 Gene:Mvd FlyBaseID:FBgn0030683 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_566995.1 Gene:AT3G54250 AraportID:AT3G54250 Length:419 Species:Arabidopsis thaliana

Alignment Length:419 Identity:194/420 (46%)
Similarity:258/420 (61%) Gaps:40/420 (10%)


  Fly     1 MFSVTCVAPVNIALIKYWGKRHEELILPVNDSISMTLSTDELCAKTTVTASESFETNRMWLNGEE 65
            :|.||...|.|||:|||||||.|..|||||||||:||..|.||..|||..|.:|:.:||||||:|
plant     7 VFMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRDRMWLNGKE 71

  Fly    66 VPFEESSRLQRCLNEVHRLA-----VASGSQKVPPTWK---LHIASVNNFPTAAGLASSAAGYAC 122
            :.. ..||.|.||.|:...|     :..|.:.....|:   |||||.|||||||||||||||:||
plant    72 ISL-SGSRYQNCLREIRGRAGDVEDMEKGIKIRKKDWEKLNLHIASHNNFPTAAGLASSAAGFAC 135

  Fly   123 LVYSLSRLYDIPLN-EELTTVARQGSGSACRSLYGGFVQWHRGALDDGSDSVARQIAPSDHWPNM 186
            ||:||::|.::..: ..|:.:||||||||||||:||||:|..|:.:|||||||.|:|...||.::
plant   136 LVFSLAKLMNVDEDPSHLSAIARQGSGSACRSLFGGFVKWTMGSKEDGSDSVAVQLADEKHWDDL 200

  Fly   187 HVLILVVNDARKKTASTRGMQQAVKTSQLIKHRVDQVVPDRIIRLREAIASHDFQAFAEITMKDS 251
            .::|.||:..:|:|:||.||:::|:||.|::||..:|||.||:::.|||.:.||.:|.::|..||
plant   201 VIIIAVVSSRQKETSSTSGMRESVETSLLLQHRAKEVVPKRILQMEEAIKNRDFASFTQLTCTDS 265

  Fly   252 NQFHAIALDTYPPCVYMNDVSHSIVSFVHDYNERMGSYHAAYTFDAGPNACLYVLAEHVP-HLLS 315
            |||||:.|||.||..||||.||.|:|.|..:|...|:...||||||||||.|......|. .||.
plant   266 NQFHAVCLDTSPPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTFDAGPNAVLIARNRKVAVQLLQ 330

  Fly   316 AIQKVFP--------------NDL-----ADGGTYLRGL-PIPKVQDAESSKLDSLDVHAKNAFR 360
            .:...||              |.:     .||.:.:..| |.|:::|    .:.|.|  .|....
plant   331 GLLYYFPPKSDTDMKSYVVGDNSILKEAGLDGASGVENLQPPPEIKD----NIGSQD--QKGEVS 389

  Fly   361 YIIHTKVGEGPKELSADNSLLIN---GLP 386
            |.|.|:.|:||..|......|::   |||
plant   390 YFICTRPGKGPIVLHDQTQALLDPETGLP 418

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MvdNP_001285295.1 PLN02407 1..322 CDD:178029 172/331 (52%)
GHMP_kinases_C 231..323 CDD:285715 46/107 (43%)
AT3G54250NP_566995.1 PLN02407 7..348 CDD:178029 173/342 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H1843
Inparanoid 1 1.050 336 1.000 Inparanoid score I645
OMA 1 1.010
OrthoDB 1 1.010 D1065019at2759
OrthoInspector 1 1.000 T125132
orthoMCL 1 0.900 OOG5_128252
Panther 1 1.100 LDO PTHR10977
Phylome 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.