DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mvd and Mvd

Sequence 1:NP_001285295.1 Gene:Mvd FlyBaseID:FBgn0030683 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_112324.1 Gene:Mvd RGDID:621292 Length:401 Species:Rattus norvegicus

Alignment Length:391 Identity:198/392 (51%)
Similarity:258/392 (66%) Gaps:12/392 (3%)


  Fly     4 VTCVAPVNIALIKYWGKRHEELILPVNDSISMTLSTDELCAKTTVTASESFETNRMWLNGEEVPF 68
            |||.||||||:|||||||.|.||||:|.|:|:||..|:|...||...|:.|..:|:||||.|...
  Rat    11 VTCTAPVNIAVIKYWGKRDEALILPINPSLSVTLHQDQLKTTTTAAISKDFTEDRIWLNGREEDV 75

  Fly    69 EESSRLQRCLNEVHRLA---VASGSQKVPPT---WKLHIASVNNFPTAAGLASSAAGYACLVYSL 127
            .: .|||.||.|:.|||   .::|.....|.   :|:|:||||||||||||||||||||||.|:|
  Rat    76 GQ-PRLQACLREIRRLARKRRSTGDGDALPLSLGYKVHVASVNNFPTAAGLASSAAGYACLAYTL 139

  Fly   128 SRLYDIPLNEELTTVARQGSGSACRSLYGGFVQWHRGALDDGSDSVARQIAPSDHWPNMHVLILV 192
            :|:|.:  ..:|:.|||:||||||||||||||:|..|...||.||:||||||..|||.:.|||||
  Rat   140 ARVYGV--EGDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQIAPEWHWPQLRVLILV 202

  Fly   193 VNDARKKTASTRGMQQAVKTSQLIKHRVDQVVPDRIIRLREAIASHDFQAFAEITMKDSNQFHAI 257
            |:..:|.|.||.|||.:|.||.|:|.|.:.:||:|:..:...|...||||||::||||||||||.
  Rat   203 VSAEKKPTGSTVGMQTSVATSTLLKFRAESIVPERMKEMTRCIQEQDFQAFAQLTMKDSNQFHAT 267

  Fly   258 ALDTYPPCVYMNDVSHSIVSFVHDYNERMGSYHAAYTFDAGPNACLYVLAEHVPHLLSAIQKVFP 322
            .|||:||..|:||.|..|:..||.:|...|....||||||||||.::.|.:.|...::|::..||
  Rat   268 CLDTFPPISYLNDTSRRIIQLVHRFNAHHGQTKVAYTFDAGPNAVIFTLEDTVAEFVAAVRHSFP 332

  Fly   323 NDLADGGTYLRGLPIPKVQDAESSKLDSLDVHAKNAFRYIIHTKVGEGPKELSADNSLLI--NGL 385
             ..|:|..:|:||.:..|..::..|.......:....:|||.|:||.||:.|...:..|:  :||
  Rat   333 -PAANGDKFLKGLQVAPVLLSDELKTSLATEPSPGGVQYIIATQVGPGPQVLDDPHHHLLGPDGL 396

  Fly   386 P 386
            |
  Rat   397 P 397

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MvdNP_001285295.1 PLN02407 1..322 CDD:178029 177/324 (55%)
GHMP_kinases_C 231..323 CDD:285715 46/92 (50%)
MvdNP_112324.1 PLN02407 9..338 CDD:178029 180/333 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C213024590
eggNOG 1 0.900 E1_COG3407
Hieranoid 1 1.000
Homologene 1 1.000 H1843
Inparanoid 1 1.050 373 1.000 Inparanoid score I2024
OMA 1 1.010
OrthoDB 1 1.010 D1065019at2759
OrthoFinder 1 1.000 FOG0004240
OrthoInspector 1 1.000 T1088761
orthoMCL 1 0.900 OOG5_128252
Panther 1 1.100 LDO PTHR10977
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.