DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mvd and mvda

Sequence 1:NP_001285295.1 Gene:Mvd FlyBaseID:FBgn0030683 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001007423.1 Gene:mvda ZFINID:ZDB-GENE-041114-127 Length:400 Species:Danio rerio

Alignment Length:393 Identity:204/394 (52%)
Similarity:261/394 (66%) Gaps:15/394 (4%)


  Fly     4 VTCVAPVNIALIKYWGKRHEELILPVNDSISMTLSTDELCAKTTVTASESFETNRMWLNGEEVPF 68
            |||.||||||:|||||||.|:||||||.|:|:||..|.|...||:..|.||..:.:||||:|...
Zfish    12 VTCTAPVNIAVIKYWGKRDEDLILPVNASLSVTLHQDHLRTTTTIACSRSFHKDCIWLNGKEQDI 76

  Fly    69 EESSRLQRCLNEVHRLAVA---SGSQKVPPTWKLHIASVNNFPTAAGLASSAAGYACLVYSLSRL 130
            .. .|||.||.|:.|||..   :|......:.|:||.|||||||||||||||||||||||:||:|
Zfish    77 SH-PRLQSCLLEIRRLAQRRKNTGDPASDVSNKVHICSVNNFPTAAGLASSAAGYACLVYTLSQL 140

  Fly   131 YDIPLNEELTTVARQGSGSACRSLYGGFVQWHRGALDDGSDSVARQIAPSDHWPNMHVLILVVND 195
            :::  ..||:.||||||||||||||||||||..|...||.||:|.|:|...:||.:.||||||:.
Zfish   141 FNV--EGELSGVARQGSGSACRSLYGGFVQWKLGEQSDGKDSIAEQVASELYWPELRVLILVVSA 203

  Fly   196 ARKKTASTRGMQQAVKTSQLIKHRVDQVVPDRIIRLREAIASHDFQAFAEITMKDSNQFHAIALD 260
            .:|...||.||..:|:||.|:|:|.|.|||.|:..:..||...||..|.|:|||||||||||.||
Zfish   204 EQKSVGSTSGMHTSVETSHLLKYRADAVVPGRMEEMIRAIRLRDFPKFGELTMKDSNQFHAICLD 268

  Fly   261 TYPPCVYMNDVSHSIVSFVHDYNERMGSYHAAYTFDAGPNACLYVLAEHVPHLLSAIQKVFPNDL 325
            ||||..|:|::||.|:|.||.||:..|....||||||||||.:|.|.:::|..:..::..||.::
Zfish   269 TYPPIFYLNNISHQIISLVHRYNQYYGETRVAYTFDAGPNAVIYSLQDYLPEFVEVVRHFFPPEV 333

  Fly   326 ADGGTYLRGLPIPKVQDAESSKLDSLDVHAK---NAFRYIIHTKVGEGPKELSADNSLLI--NGL 385
            .: ..:.:|||   |..|:.|:....|::.|   |..||:|.||.|.||:.:...|..|:  :||
Zfish   334 NE-EEFFKGLP---VCPADLSEEMIRDINMKPTPNGIRYMISTKAGPGPRVVEDPNLHLLGADGL 394

  Fly   386 PLK 388
            |.|
Zfish   395 PKK 397

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MvdNP_001285295.1 PLN02407 1..322 CDD:178029 180/321 (56%)
GHMP_kinases_C 231..323 CDD:285715 49/92 (53%)
mvdaNP_001007423.1 PLN02407 11..332 CDD:178029 181/323 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C213019650
eggNOG 1 0.900 E1_COG3407
Hieranoid 1 1.000
Homologene 1 1.000 H1843
Inparanoid 1 1.050 377 1.000 Inparanoid score I1997
OMA 1 1.010
OrthoDB 1 1.010 D1065019at2759
OrthoFinder 1 1.000 FOG0004240
OrthoInspector 1 1.000 T1054360
orthoMCL 1 0.900 OOG5_128252
Panther 1 1.100 LDO PTHR10977
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R783
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.