DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mvd and MVD

Sequence 1:NP_001285295.1 Gene:Mvd FlyBaseID:FBgn0030683 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_011521388.1 Gene:MVD HGNCID:7529 Length:434 Species:Homo sapiens

Alignment Length:427 Identity:193/428 (45%)
Similarity:260/428 (61%) Gaps:48/428 (11%)


  Fly     3 SVTCVAPVNIALIKYWGKRHEELILPVNDSISMTLSTDELCAKTTVTASESFETNRMWLNGEEVP 67
            :|||.||||||:|||||||.|||:||:|.|:|:||..|:|...||...|:.|..:|:||||.|..
Human     9 AVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTEDRIWLNGREED 73

  Fly    68 FEESSRLQRCLNEVHRLAVASGSQK----VPP--TWKLHIASVNNFPTAAGLASSAAGYACLV-- 124
            ..: .|||.||.|:..||....:.:    :|.  :.|:|:|||||||||||||||||||||||  
Human    74 VGQ-PRLQACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTAAGLASSAAGYACLVAA 137

  Fly   125 --------------------------------YSLSRLYDIPLNEELTTVARQGSGSACRSLYGG 157
                                            |:|:|:|.:  ..:|:.|||:||||||||||||
Human   138 GVGLSPVIPVLKRLMGEKHCRPGVQDQPGQHTYTLARVYGV--ESDLSEVARRGSGSACRSLYGG 200

  Fly   158 FVQWHRGALDDGSDSVARQIAPSDHWPNMHVLILVVNDARKKTASTRGMQQAVKTSQLIKHRVDQ 222
            ||:|..|...||.||:|||:||..|||.:.||||||:..:|.|.||.||:.:|:||.|::.|.:.
Human   201 FVEWQMGEQADGKDSIARQVAPESHWPELRVLILVVSAEKKLTGSTVGMRASVETSPLLRFRAES 265

  Fly   223 VVPDRIIRLREAIASHDFQAFAEITMKDSNQFHAIALDTYPPCVYMNDVSHSIVSFVHDYNERMG 287
            |||.|:..:...|...||.:||::||||||||||..|||:||..|:|.:|..|:..||.:|...|
Human   266 VVPARMAEMARCIRERDFPSFAQLTMKDSNQFHATCLDTFPPISYLNAISWRIIHLVHRFNAHHG 330

  Fly   288 SYHAAYTFDAGPNACLYVLAEHVPHLLSAIQKVFPNDLADGGTYLRGLPI-PKVQDAESSKLDSL 351
            ....||||||||||.::.|.:.|...::|:...||.. ::|.|:|:||.: |....||.....::
Human   331 DTKVAYTFDAGPNAVIFTLDDTVAEFVAAVWHGFPPG-SNGDTFLKGLQVRPAPLSAELQAALAM 394

  Fly   352 DVHAKNAFRYIIHTKVGEGPKELSADNSLLI--NGLP 386
            : ......:|||.|:||.||:.|....:.|:  :|||
Human   395 E-PTPGGVKYIIVTQVGPGPQILDDPCAHLLGPDGLP 430

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MvdNP_001285295.1 PLN02407 1..322 CDD:178029 171/359 (48%)
GHMP_kinases_C 231..323 CDD:285715 43/92 (47%)
MVDXP_011521388.1 PLN02407 10..371 CDD:178029 173/365 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C213026002
eggNOG 1 0.900 E1_COG3407
Hieranoid 1 1.000
Homologene 1 1.000 H1843
Inparanoid 1 1.050 356 1.000 Inparanoid score I2202
Isobase 1 0.950 0 Normalized mean entropy S814
OMA 1 1.010
OrthoDB 1 1.010 D1065019at2759
OrthoFinder 1 1.000 FOG0004240
OrthoInspector 1 1.000 T1075104
orthoMCL 1 0.900 OOG5_128252
Panther 1 1.100 LDO PTHR10977
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.720

Return to query results.
Submit another query.