DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mvd and mvd

Sequence 1:NP_001285295.1 Gene:Mvd FlyBaseID:FBgn0030683 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_004913618.1 Gene:mvd XenbaseID:XB-GENE-975218 Length:417 Species:Xenopus tropicalis

Alignment Length:401 Identity:210/402 (52%)
Similarity:266/402 (66%) Gaps:22/402 (5%)


  Fly     1 MFSVTCVAPVNIALIKYWGKRHEELILPVNDSISMTLSTDELCAKTTVTASESFETNRMWLNGEE 65
            |..|||.||||||:|||||||:||||||:|.|:|:||..|:|...|:..||..|..:|:||||:|
 Frog    24 MKKVTCTAPVNIAVIKYWGKRNEELILPINSSLSVTLHQDQLKTTTSAAASREFTEDRIWLNGKE 88

  Fly    66 VPFEESS--RLQRCLNEVHRLA----VASGSQKVPPTW--KLHIASVNNFPTAAGLASSAAGYAC 122
               |..|  |||.||.|:.|||    ...|.:.|....  |:||.||||||||||||||||||||
 Frog    89 ---ENISHPRLQSCLREIRRLARKRRNEEGDENVSRILNDKVHICSVNNFPTAAGLASSAAGYAC 150

  Fly   123 LVYSLSRLYDIPLNEELTTVARQGSGSACRSLYGGFVQWHRGALDDGSDSVARQIAPSDHWPNMH 187
            |||:|::||.:  ..||:.:|||||||||||:|||||||..|..|||.||:|:|:.|..|||.:.
 Frog   151 LVYTLAKLYGV--EGELSEIARQGSGSACRSMYGGFVQWVMGERDDGKDSLAKQVEPESHWPELR 213

  Fly   188 VLILVVNDARKKTASTRGMQQAVKTSQLIKHRVDQVVPDRIIRLREAIASHDFQAFAEITMKDSN 252
            |||||....:|...||.|||.:|:||.|:|.|.|.|||:|:..:.|:|...||:||.|:||||||
 Frog   214 VLILVATAEKKHVGSTAGMQTSVETSPLLKLRADLVVPERMEAMIESIRKKDFKAFGELTMKDSN 278

  Fly   253 QFHAIALDTYPPCVYMNDVSHSIVSFVHDYNERMGSYHAAYTFDAGPNACLYVLAEHVPHLLSAI 317
            ||||..||||||..|:|.||..::|.||.||...|....||:|||||||.:::|...|...:..:
 Frog   279 QFHATCLDTYPPIFYLNSVSQRVISVVHQYNTYYGQTKVAYSFDAGPNAVIFMLEPTVNEFVEVV 343

  Fly   318 QKVFPNDLADGGTYLRGLPIPKVQDAESSKLDSLDVHAKN--AFRYIIHTKVGEGPKELSADNSL 380
            :..||.: ::|.|||:|||:.....:|.  |.|:.....|  ..||||:||.|.|| .||.|.:|
 Frog   344 KHCFPPE-SNGDTYLKGLPVGSAVLSEG--LQSIVASDPNPGGVRYIIYTKPGPGP-TLSQDLTL 404

  Fly   381 LI---NGLPLK 388
            .:   :||||:
 Frog   405 DLLDADGLPLQ 415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MvdNP_001285295.1 PLN02407 1..322 CDD:178029 181/329 (55%)
GHMP_kinases_C 231..323 CDD:285715 46/92 (50%)
mvdXP_004913618.1 PLN02407 27..354 CDD:178029 182/333 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C213021056
eggNOG 1 0.900 E1_COG3407
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H1843
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1065019at2759
OrthoFinder 1 1.000 FOG0004240
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.