DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mvd and mvd1

Sequence 1:NP_001285295.1 Gene:Mvd FlyBaseID:FBgn0030683 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_594027.1 Gene:mvd1 PomBaseID:SPAC24C9.03 Length:393 Species:Schizosaccharomyces pombe

Alignment Length:386 Identity:175/387 (45%)
Similarity:241/387 (62%) Gaps:14/387 (4%)


  Fly     1 MFSVTCVAPVNIALIKYWGKRHEELILPVNDSISMTLSTDELCAKTTVTASESFETNRMWLNGEE 65
            ::..|..||||||:|||||||...|.||.|.|||:|||.|:|...||.:.||.||.:.:||||..
pombe     5 VYQCTVSAPVNIAVIKYWGKRDVALNLPTNSSISVTLSQDDLRTVTTASCSEKFENDTLWLNGNA 69

  Fly    66 VPFEESSRLQRCLNEVH--RLAVASGSQKVPP--TWKLHIASVNNFPTAAGLASSAAGYACLVYS 126
            .....:.||:.|:.|:.  ||.:...:..:..  ..|||:.|.|||||||||||||||||....:
pombe    70 EEIFANKRLRVCVEELRKARLDLEEENDDLDKIGALKLHVVSENNFPTAAGLASSAAGYAAFCEA 134

  Fly   127 LSRLYDIPLN-EELTTVARQGSGSACRSLYGGFVQWHRGALDDGSDSVARQIAPSDHWPNMHVLI 190
            ::||||:|.. .:|:.:||||||||||||:||:|.|..|.|..|:||||.|:.|.::||.:.|.:
pombe   135 IARLYDLPWTPTQLSRIARQGSGSACRSLFGGYVAWEMGELHSGADSVAVQVEPVENWPEIRVAV 199

  Fly   191 LVVNDARKKTASTRGMQQAVKTSQLIKHRVDQVVPDRIIRLREAIASHDFQAFAEITMKDSNQFH 255
            ||.:.|:|..:||.|||..|.:|.|.:||:..:||.||..::.||...||:.||::||.||||||
pombe   200 LVASAAKKGVSSTAGMQATVASSTLFQHRIQNIVPQRIQEMKTAIRERDFETFAKLTMTDSNQFH 264

  Fly   256 AIALDTYPPCVYMNDVSHSIVSFVHDYNERMGSYHAAYTFDAGPNACLYVLAEHVPHLLSAIQKV 320
            |..|||:||..|:||.|.:::..|.:.|...|...|||||||||||.:|.|.|:...:|:.:..|
pombe   265 ACCLDTFPPIFYLNDTSRAVIRVVENINATAGKTIAAYTFDAGPNAVIYFLEENSEIVLNTLYAV 329

  Fly   321 FPNDLADGGTYLRGLPIPKVQDAESSKLDSLDVHAKNAFRYIIHTKVGEGPKELSADNSLL 381
            ..|  |:|.:...| ..|...|:.::.:.|      :....:|.|:||.||:.|:.|.||:
pombe   330 TKN--AEGWSKQYG-SSPVTVDSAAANIVS------SGISRVILTRVGNGPRVLTIDESLI 381

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MvdNP_001285295.1 PLN02407 1..322 CDD:178029 158/326 (48%)
GHMP_kinases_C 231..323 CDD:285715 43/92 (47%)
mvd1NP_594027.1 PLN02407 5..316 CDD:178029 155/311 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H1843
Inparanoid 1 1.050 322 1.000 Inparanoid score I541
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004240
OrthoInspector 1 1.000 T1125780
orthoMCL 1 0.900 OOG5_128252
Panther 1 1.100 LDO PTHR10977
Phylome 1 0.910 0.980 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R783
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.