DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MagR and ISA2

DIOPT Version :10

Sequence 1:NP_001259579.1 Gene:MagR / 32513 FlyBaseID:FBgn0026666 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_015392.1 Gene:ISA2 / 856180 SGDID:S000006271 Length:185 Species:Saccharomyces cerevisiae


Alignment Length:127 Identity:32/127 - (25%)
Similarity:60/127 - (47%) Gaps:23/127 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LTLTPAAVLRIKTLLQDKPDMVGLKVGVRQRGCNGLSY--TLDYASQK-----------ADKLDE 77
            |:::..|..|:..:.::..:  .|::.|...||:|..|  ||:.|::.           :|.||:
Yeast    59 LSISERASNRLAEIYRNSKE--NLRISVESGGCHGFQYNLTLEPATKPDIKNDVKDKEFSDDLDD 121

  Fly    78 E--------VVQDGVKVFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKGTCGCGESFSM 131
            :        :.:|..:|.||.|:...|..|.:.:....:.|.|...|.::|.:||||.||.:
Yeast   122 DDSKDIIYVLPEDKGRVIIDSKSLNILNNTTLTYTNELIGSSFKIINGSLKSSCGCGSSFDI 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MagRNP_001259579.1 IscA 25..131 CDD:440085 32/125 (26%)
ISA2NP_015392.1 IscA 58..183 CDD:440085 32/125 (26%)

Return to query results.
Submit another query.