DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MagR and ISA1

DIOPT Version :8

Sequence 1:NP_001259579.1 Gene:MagR / 32513 FlyBaseID:FBgn0026666 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_013073.1 Gene:ISA1 / 850632 SGDID:S000003950 Length:250 Species:Saccharomyces cerevisiae

Alignment Length:114 Identity:60/115 (52%)
Similarity:83/115 (72%) Gaps:4/115 (3%)


  Fly    17 RKLIPTRAALTLTPAAVLRIKTLL-QDKPDMVGLKVGVRQRGCNGLSYTLDYASQKADKLDEEVV 80
            |||.|.:|.:||:|.|:..::.|| |.:|.::  :|..|.|||:||:|.|.|.::.. |.||.|.
Yeast   138 RKLRPRKALITLSPKAIKHLRALLAQPEPKLI--RVSARNRGCSGLTYDLQYITEPG-KFDEVVE 199

  Fly    81 QDGVKVFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKGTCGCGESF 129
            |||||:.||.||..|::|:|||:::.||:|:|||.|||.||||||||||
Yeast   200 QDGVKIVIDSKALFSIIGSEMDWIDDKLASKFVFKNPNSKGTCGCGESF 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MagRNP_001259579.1 TIGR00049 27..130 CDD:272875 55/105 (52%)
ISA1NP_013073.1 TIGR00049 148..250 CDD:272875 55/105 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C279507946
eggNOG 1 0.900 E1_COG0316
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004104
OrthoInspector 1 1.000 T1136065
orthoMCL 1 0.900 OOG5_127222
Panther 1 1.100 LDO PTHR10072
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R617
TreeFam 1 0.960
98.730

Return to query results.
Submit another query.