DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MagR and Isca1

DIOPT Version :8

Sequence 1:NP_001259579.1 Gene:MagR / 32513 FlyBaseID:FBgn0026666 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_853657.1 Gene:Isca1 / 290985 RGDID:727792 Length:129 Species:Rattus norvegicus

Alignment Length:123 Identity:96/124 (77%)
Similarity:109/124 (88%) Gaps:1/124 (1%)


  Fly     9 ATVRAVKGRKLIPTRAALTLTPAAVLRIKTLLQDKPDMVGLKVGVRQRGCNGLSYTLDYASQKAD 73
            ||||||..|||.||||||||||:||.:||.||:|||:.||||||||.||||||||:|:|...|.|
  Rat     8 ATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGLKVGVRTRGCNGLSYSLEYTKTKGD 72

  Fly    74 KLDEEVVQDGVKVFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKGTCGCGESFSM 131
             .||||:||||:|||:|||||:|||||||:||.|||||||||||||||||||||||::
  Rat    73 -ADEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNV 129

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MagRNP_001259579.1 TIGR00049 27..130 CDD:272875 81/103 (79%)
Isca1NP_853657.1 TIGR00049 26..129 CDD:272875 81/104 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C279477785
eggNOG 1 0.900 E1_COG0316
Hieranoid 1 1.000
Homologene 1 1.000 H87862
Inparanoid 1 1.050 193 1.000 Inparanoid score I3719
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004104
OrthoInspector 1 1.000 T1087033
orthoMCL 1 0.900 OOG5_127222
Panther 1 1.100 LDO PTHR10072
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.760

Return to query results.
Submit another query.