DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12379 and AT1G68730

DIOPT Version :8

Sequence 1:NP_573061.2 Gene:CG12379 / 32512 FlyBaseID:FBgn0030676 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_177040.2 Gene:AT1G68730 / 843204 AraportID:AT1G68730 Length:170 Species:Arabidopsis thaliana

Alignment Length:151 Identity:36/151 - (23%)
Similarity:69/151 - (45%) Gaps:26/151 - (17%)


  Fly     5 KKFYK----ISAGVRRGALLTSSRRTQIDALNSPQLQLQVHHFATKTQTAVFSSSNNYTCICRSI 65
            :.|||    |||       |..|:.|::..:.:|:.:        ....:||.|..:.:.:    
plant    37 RPFYKQQNPISA-------LHRSKTTRVIEVVTPKQR--------NRSFSVFGSLADDSKL---- 82

  Fly    66 HCSKPVDDADKTVATNSIPLAKLEAKMQLIYTCKVCQTRNMKTISKLAYQRGVVIVTCEGCSNHH 130
               .|.::::.:....||.:......:|:.:||..|..|..:.|::.||::|:|.|.|.||..||
plant    83 ---NPDEESNDSAEVASIDIKLPRRSLQVEFTCNSCGERTKRLINRHAYEKGLVFVQCAGCLKHH 144

  Fly   131 LIADNLNWFTDLDGKRNIEEI 151
            .:.|||....:.|.:...:::
plant   145 KLVDNLGLIVEYDFRETSKDL 165

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12379NP_573061.2 zf-DNL 93..158 CDD:282966 20/59 (34%)
AT1G68730NP_177040.2 zf-DNL 107..165 CDD:282966 20/57 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1626191at2759
OrthoInspector 1 1.000 T32266
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR20922
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.