DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12379 and AT5G27280

DIOPT Version :10

Sequence 1:NP_573061.2 Gene:CG12379 / 32512 FlyBaseID:FBgn0030676 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_198080.1 Gene:AT5G27280 / 832786 AraportID:AT5G27280 Length:212 Species:Arabidopsis thaliana


Alignment Length:77 Identity:27/77 - (35%)
Similarity:39/77 - (50%) Gaps:2/77 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SKPVDDADKTVATN--SIPLAKLEAKMQLIYTCKVCQTRNMKTISKLAYQRGVVIVTCEGCSNHH 130
            |.|......||:|.  |:.......:|::.:||.||..|..:.|:..||..|.|.|.|.||:..|
plant    95 SLPAKTDTDTVSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFH 159

  Fly   131 LIADNLNWFTDL 142
            .:.||||.|.::
plant   160 KLVDNLNLFHEV 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12379NP_573061.2 zf-DNL 93..158 CDD:461571 20/50 (40%)
AT5G27280NP_198080.1 zf-DNL 123..>168 CDD:461571 19/44 (43%)

Return to query results.
Submit another query.