DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12379 and dnlz

DIOPT Version :8

Sequence 1:NP_573061.2 Gene:CG12379 / 32512 FlyBaseID:FBgn0030676 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001074117.1 Gene:dnlz / 791166 ZFINID:ZDB-GENE-070112-1482 Length:183 Species:Danio rerio

Alignment Length:158 Identity:70/159 (44%)
Similarity:90/159 (57%) Gaps:35/159 (22%)


  Fly    16 RGALLTSSRRTQIDALNSPQLQLQVHHFATKTQTAVFSSSNNYTCI----------CRSIHCSKP 70
            |||.:.|...||...|      .:|.|   :...:.|::|...:.:          |||.     
Zfish    18 RGAGVLSVPETQRVTL------ARVRH---EESNSAFTNSTLRSDVGHDTGLGLSFCRSF----- 68

  Fly    71 VDDADKTVATNSIPLAKLEA-KMQLIYTCKVCQTRNMKTISKLAYQRGVVIVTCEGCSNHHLIAD 134
                    :|.:|  .:|:: ...|:||||||.||:||.||||||.:|||||||.||.|||:|||
Zfish    69 --------STEAI--GQLQSTHYHLVYTCKVCSTRSMKKISKLAYHKGVVIVTCPGCKNHHVIAD 123

  Fly   135 NLNWFTDLDGKRNIEEILAEKGEKVVRL 162
            ||.||:||:||||||||||.|||.|.|:
Zfish   124 NLKWFSDLEGKRNIEEILAAKGESVRRV 151

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12379NP_573061.2 zf-DNL 93..158 CDD:282966 51/65 (78%)
dnlzNP_001074117.1 zf-DNL 82..147 CDD:282966 51/65 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C244419231
eggNOG 1 0.900 E1_KOG3277
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1626191at2759
OrthoFinder 1 1.000 FOG0003327
OrthoInspector 1 1.000 T1054362
orthoMCL 1 0.900 OOG5_128569
Panther 1 1.100 LDO PTHR20922
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1685
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.740

Return to query results.
Submit another query.