DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12379 and Dnlz

DIOPT Version :8

Sequence 1:NP_573061.2 Gene:CG12379 / 32512 FlyBaseID:FBgn0030676 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_081104.1 Gene:Dnlz / 52838 MGIID:106559 Length:177 Species:Mus musculus

Alignment Length:88 Identity:58/89 (65%)
Similarity:71/89 (80%) Gaps:2/89 (2%)


  Fly    85 LAKLEA-KMQLIYTCKVCQTRNMKTISKLAYQRGVVIVTCEGCSNHHLIADNLNWFTDLDGKRNI 148
            |.::|| ..||:||||||.||:.|.||||||.:|||||||.||.|||:|||||:||:||.|||||
Mouse    65 LGRVEADHYQLVYTCKVCGTRSSKRISKLAYHQGVVIVTCPGCQNHHIIADNLSWFSDLKGKRNI 129

  Fly   149 EEILAEKGEKVVRLT-DGNCEFL 170
            |||||.:||:|.|:: ||..|.:
Mouse   130 EEILAARGEEVRRVSGDGALELI 152

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12379NP_573061.2 zf-DNL 93..158 CDD:282966 50/65 (77%)
DnlzNP_081104.1 zf-DNL 74..139 CDD:282966 50/65 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C244419135
eggNOG 1 0.900 E1_KOG3277
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003327
OrthoInspector 1 1.000 T1085213
orthoMCL 1 0.900 OOG5_128569
Panther 1 1.100 LDO PTHR20922
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1685
TreeFam 1 0.960
109.730

Return to query results.
Submit another query.