DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HUWE1 and nedd4l

DIOPT Version :10

Sequence 1:NP_001285288.1 Gene:HUWE1 / 32510 FlyBaseID:FBgn0030674 Length:5151 Species:Drosophila melanogaster
Sequence 2:XP_012815048.1 Gene:nedd4l / 448382 XenbaseID:XB-GENE-489248 Length:1290 Species:Xenopus tropicalis


Alignment Length:46 Identity:10/46 - (21%)
Similarity:16/46 - (34%) Gaps:3/46 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLIGAFGIVESTVKCPKSTFGVELEC---AFECCTSFEGRDQGYYC 51
            ::|..:.|:|......|....:|...   .|.|.....|.|...:|
 Frog   330 VMIHRYCIIEQLESILKDVANMEQHINHDIFVCIIISRGNDDSIFC 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HUWE1NP_001285288.1 DUF908 90..326 CDD:428721
DUF913 621..989 CDD:461803
UBA_like_SF 1467..1506 CDD:473871
WWE 1756..1828 CDD:128922
DUF5585 3288..3672 CDD:465521
UBM 3670..3700 CDD:464159
UBM 3719..3746 CDD:464159
HECTc 4796..5149 CDD:238033
nedd4lXP_012815048.1 C2 <389..442 CDD:472691
WW 485..513 CDD:459800
WW 683..712 CDD:459800
WW 796..826 CDD:238122
WW 845..896 CDD:197736
HECTc 957..1286 CDD:214523
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.