powered by:
Protein Alignment CG8134 and Lamtor2
DIOPT Version :9
Sequence 1: | NP_001285283.1 |
Gene: | CG8134 / 32507 |
FlyBaseID: | FBgn0030671 |
Length: | 345 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_112538.1 |
Gene: | Lamtor2 / 83409 |
MGIID: | 1932697 |
Length: | 125 |
Species: | Mus musculus |
Alignment Length: | 66 |
Identity: | 15/66 - (22%) |
Similarity: | 26/66 - (39%) |
Gaps: | 8/66 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 214 IVDNV---YERRGARMYGELLRRVEVLRLLLLVHLNLPPARQSPAHIKLIEYYYNLAQFESLPCS 275
|..|: |:|.|.:.:.| :.|:.:|:..:....|....|::.|..|......|..|...
Mouse 48 IASNIWAAYDRNGNQAFNE-----DSLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAK 107
Fly 276 A 276
|
Mouse 108 A 108
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
1 | 0.960 |
|
Return to query results.
Submit another query.