DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8134 and F8A1

DIOPT Version :8

Sequence 1:NP_001285283.1 Gene:CG8134 / 32507 FlyBaseID:FBgn0030671 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_036283.2 Gene:F8A1 / 8263 HGNCID:3547 Length:371 Species:Homo sapiens

Alignment Length:397 Identity:90/398 (23%)
Similarity:125/398 (31%) Gaps:154/398 (39%)


  Fly     9 LGGGGSSSGAPSTAPGHEHHQLEQYQYPKNLIEQYLRASSKIKKFERAGFFKRF--APSVVDVQA 71
            |||||:       .||.|         ..:.:.:|...|:|:|        |||  .|:|.:...
Human     8 LGGGGA-------GPGPE---------AGDFLARYRLVSNKLK--------KRFLRKPNVAEAGE 48

  Fly    72 DFQRLAYSFEESGIQQYAAMCHIGYAKCESYGGAPQRESEAYLRAARSFL-------------AA 123
            .|.:|...........|||.|.:..|:|:........|:.|...|||.||             ||
Human    49 QFGQLGRELRAQECLPYAAWCQLAVARCQQALFHGPGEALALTEAARLFLRQERDARQRLVCPAA 113

  Fly   124 HNE-----------SGRLHLRTRHSGFREGAVHCYHRAADRAVDGCVFKAAILRELKQ------- 170
            :.|           :.||||.....            ||..|:  |:..||.||:|.|       
Human   114 YGEPLQAAASALGAAVRLHLELGQP------------AAAAAL--CLELAAALRDLGQPAAAAGH 164

  Fly   171 ----LQRQL----------------------DSTSSFASPT--------HQIHDLE--------- 192
                .|.||                      |.|.:.|..|        |..|.::         
Human   165 FQRAAQLQLPQLPLAALQALGEAASCQLLARDYTGALAVFTRMQRLAREHGSHPVQSLPPPPPPA 229

  Fly   193 --------------ISAETSGQRGDFRSALQHYDDIVDNVYERRGARMYGELLRRVEVLRLLLLV 243
                          :....||......:||..:.|:                |.|.||.|:|||:
Human   230 PQPGPGATPALPAALLPPNSGSAAPSPAALGAFSDV----------------LVRCEVSRVLLLL 278

  Fly   244 HLNLPPARQSPAHIKLIEYYYNLAQFESLPCSADDGGSAERPGAFVPEQQQYALAEITCAWVERK 308
            .|..|||:..|.|.:.:|.|         ...|.|....|..|. :||:....|..:..|..|:.
Human   279 LLQPPPAKLLPEHAQTLEKY---------SWEAFDSHGQESSGQ-LPEELFLLLQSLVMATHEKD 333

  Fly   309 MCDLKHL 315
            ...:|.|
Human   334 TEAIKSL 340



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C158260884
eggNOG 1 0.900 E1_28IE5
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004626
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133420
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
54.690

Return to query results.
Submit another query.