DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8134 and f8a1

DIOPT Version :9

Sequence 1:NP_001285283.1 Gene:CG8134 / 32507 FlyBaseID:FBgn0030671 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001072171.1 Gene:f8a1 / 594919 XenbaseID:XB-GENE-5866629 Length:317 Species:Xenopus tropicalis


Alignment Length:318 Identity:77/318 - (24%)
Similarity:122/318 - (38%) Gaps:73/318 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 QYLRASSKIKKFERAGFFKRF--APSVVDVQADFQRLAYSFEESGIQQYAAMCHIGYAKCE-SYG 103
            :|...|:|:|        |||  .|:|.:....|.:||...::....|||..|::..|:|| :..
 Frog    10 RYRAVSNKLK--------KRFLRKPNVAEASEQFGQLAKELKQQDCLQYAGFCNLAMARCEQTLF 66

  Fly   104 GAPQRESEAYLRAARSFLAAHNESGRLHLRTRHSGFRE---GAVHCYHRAAD---------RAVD 156
            .|| .|:.|...|||.||....|:.||    :..||.|   .|::||..|..         .|..
 Frog    67 NAP-GEAMALTEAARLFLQEEKETQRL----KCPGFEEHLQAAINCYSFAIKVYIELNQPVMAAS 126

  Fly   157 GCVFKAAILRELKQL-------QRQLDSTSSFASPTHQIHDLEISAETSGQRGDFRSALQHYDDI 214
            .|:.....|:::.:|       ||..:..:..  |...:..|...|.......|:..||..:.: 
 Frog   127 LCLELGNALKDMSKLGEAIVYFQRAAELQTQV--PIECLLSLGYVASCKIMTRDYDGALAVFTE- 188

  Fly   215 VDNVYERRGARMYG---------ELLRRVEVLRLLLLVHLNLPPARQSPAHIKLIEYY------- 263
            :..:.:.:|....|         :::.:.||.|:|||:.|..||.:..|.|.:.:|.|       
 Frog   189 MQLLAQEKGLHTPGNSLPVGAFLDIIAKCEVSRVLLLMLLQPPPQKLLPEHAQTLEKYDWEAFDS 253

  Fly   264 -----------YNLAQFESLPCSADDGGS-----AERPGAFVPEQQ---QYALAEITC 302
                       :.|.|...:.|..:|..|     .|......|||.   ...|.|:.|
 Frog   254 HSHVNYLTEEVFLLLQSVVMACQENDVESLKVLQVELWPLLTPEQNHLLHLVLQEMIC 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8134NP_001285283.1 None
f8a1NP_001072171.1 SNAP 16..>188 CDD:329252 48/186 (26%)
TPR repeat 27..64 CDD:276937 11/36 (31%)
TPR repeat 69..118 CDD:276937 18/53 (34%)
TPR repeat 121..154 CDD:276937 6/32 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I5249
OMA 1 1.010 - - QHG52481
OrthoDB 1 1.010 - - D1141704at2759
OrthoFinder 1 1.000 - - FOG0007113
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16797
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.170

Return to query results.
Submit another query.