powered by:
Protein Alignment CG8134 and LAMTOR2
DIOPT Version :9
| Sequence 1: | NP_001285283.1 |
Gene: | CG8134 / 32507 |
FlyBaseID: | FBgn0030671 |
Length: | 345 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_054736.1 |
Gene: | LAMTOR2 / 28956 |
HGNCID: | 29796 |
Length: | 125 |
Species: | Homo sapiens |
| Alignment Length: | 66 |
Identity: | 15/66 - (22%) |
| Similarity: | 26/66 - (39%) |
Gaps: | 8/66 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 214 IVDNV---YERRGARMYGELLRRVEVLRLLLLVHLNLPPARQSPAHIKLIEYYYNLAQFESLPCS 275
|..|: |:|.|.:.:.| :.|:.:|:..:....|....|::.|..|......|..|...
Human 48 IASNIWAAYDRNGNQAFNE-----DNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAK 107
Fly 276 A 276
|
Human 108 A 108
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
1 |
0.960 |
- |
- |
|
|
| User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.960 |
|
Return to query results.
Submit another query.