DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8134 and LAMTOR2

DIOPT Version :9

Sequence 1:NP_001285283.1 Gene:CG8134 / 32507 FlyBaseID:FBgn0030671 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_054736.1 Gene:LAMTOR2 / 28956 HGNCID:29796 Length:125 Species:Homo sapiens


Alignment Length:66 Identity:15/66 - (22%)
Similarity:26/66 - (39%) Gaps:8/66 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 IVDNV---YERRGARMYGELLRRVEVLRLLLLVHLNLPPARQSPAHIKLIEYYYNLAQFESLPCS 275
            |..|:   |:|.|.:.:.|     :.|:.:|:..:....|....|::.|..|......|..|...
Human    48 IASNIWAAYDRNGNQAFNE-----DNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAK 107

  Fly   276 A 276
            |
Human   108 A 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8134NP_001285283.1 None
LAMTOR2NP_054736.1 Robl_LC7 5..95 CDD:397386 11/51 (22%)
Required for location at endosomes. /evidence=ECO:0000250 57..70 3/17 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.