DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8134 and F8a

DIOPT Version :8

Sequence 1:NP_001285283.1 Gene:CG8134 / 32507 FlyBaseID:FBgn0030671 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_032004.2 Gene:F8a / 14070 MGIID:95474 Length:381 Species:Mus musculus

Alignment Length:383 Identity:92/383 - (24%)
Similarity:129/383 - (33%) Gaps:115/383 - (30%)


  Fly     8 SLGGG---GSSSGAPSTAPGHEHHQLEQYQYPKNLIEQYLRASSKIKKFERAGFFKRF--APSVV 67
            |||||   ||.:|                    :.:.:|.:.|:|:|        |||  .|:|.
Mouse     8 SLGGGAWPGSEAG--------------------DFLARYRQVSNKLK--------KRFLRKPNVA 44

  Fly    68 DVQADFQRLAYSFEESGIQQYAAMCHIGYAKCESYGGAPQRESEAYLRAARSFL----------- 121
            :....|.:||..........|||.|.:..|:|:........|:.|...|||.||           
Mouse    45 EAGEQFAQLARELRAQECLPYAAWCQLAVARCQQALFHGPGEALALTEAARLFLRQECDARQRLG 109

  Fly   122 --AAHNE-----------SGRLHLRTRHSGFREGAVHCYHRAAD-RAVDGCVFKAAILRELKQLQ 172
              ||:.|           :.||||......  ..|..|...||. |||......|...:...||.
Mouse   110 CPAAYGEPLQAAASALGAAVRLHLELGQPA--AAAALCLELAAALRAVGQPAAAAGHFQRAAQLH 172

  Fly   173 RQL--------------------DSTSSFASPT-----------HQIHDLEISAE--------TS 198
            ..|                    |.|.:.|..|           |.:..||:..:        .|
Mouse   173 LPLMPLAALQALGDAASCQLLARDYTGALALFTRMQRLAREHGGHPVQQLELLPQPPSGPQPPLS 237

  Fly   199 GQR-----GDFRSALQHYDDIVDNVYERRGA-RMYGELLRRVEVLRLLLLVHLNLPPARQSPAHI 257
            |.:     |......|..|....:|....|. ..:.::|.|.||.|:|||:.|..|||:..|.|.
Mouse   238 GPQPRPVLGSTLPLPQPPDHAPGSVAPSPGTLGAFADVLVRCEVSRVLLLLLLQPPPAKLLPEHA 302

  Fly   258 KLIEYYYNLAQFESLPCSADDGGSAERPGAFVPEQQQYALAEITCAWVERKMCDLKHL 315
            :.:|.|         ...|.||...:..|. :||:....|..:..|..|:....:|.|
Mouse   303 QTLEKY---------SWEAFDGHGQDTSGQ-LPEELFLLLQSLVMAAQEKDTEGIKKL 350



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C158260561
eggNOG 1 0.900 E1_28IE5
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004626
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133420
Panther 1 1.100 LDO PTHR16797
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R6996
TreeFam 1 0.960
76.820

Return to query results.
Submit another query.