DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9240 and TPP

DIOPT Version :8

Sequence 1:NP_573054.2 Gene:CG9240 / 32505 FlyBaseID:FBgn0030669 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_180603.2 Gene:TPP / 817595 AraportID:AT2G30440 Length:340 Species:Arabidopsis thaliana

Alignment Length:168 Identity:52/169 (31%)
Similarity:79/169 (47%) Gaps:20/169 (12%)


  Fly    16 AYAAITHCTFEYIGDFVLCK-----GPSMEPTLHSDNVLLTERLSKHWRTYQPGDIVIAISP--- 72
            |.||.|..|...:....|.:     ..||.|||...:.::.|::|..:|..:..||||..:|   
plant   157 AKAAFTAVTVSILFRSALAEPKSIPSTSMYPTLDKGDRVMAEKVSYFFRKPEVSDIVIFKAPPIL 221

  Fly    73 --------IKADQFICKRIVAVSGDQVLIQKPIPIEAEFSGNSDDKKKPV---MVKDYVPRGHVW 126
                    ...|.|| |||||..||.|.::.......:.....|...:|:   |...:||:|:|:
plant   222 LEYPEYGYSSNDVFI-KRIVASEGDWVEVRDGKLFVNDIVQEEDFVLEPMSYEMEPMFVPKGYVF 285

  Fly   127 IEGDNKGNSSDSRYYGPIPVGLIRSRVLCRIWPISEAT 164
            :.|||:..|.||..:||:|:..|..|.:.|.||.|:.:
plant   286 VLGDNRNKSFDSHNWGPLPIENIVGRSVFRYWPPSKVS 323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9240NP_573054.2 sigpep_I_bact 30..159 CDD:274044 45/148 (30%)
S26_SPase_I 31..153 CDD:119398 43/141 (30%)
Peptidase_S24_S26 <81..145 CDD:299172 23/67 (34%)
TPPNP_180603.2 sigpep_I_bact 173..320 CDD:274044 46/148 (31%)
S26_SPase_I 176..311 CDD:119398 41/136 (30%)
Peptidase_S24_S26 <236..318 CDD:299172 29/83 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1211147at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.