DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9240 and SPBC336.13c

DIOPT Version :8

Sequence 1:NP_573054.2 Gene:CG9240 / 32505 FlyBaseID:FBgn0030669 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_596133.1 Gene:SPBC336.13c / 2540235 PomBaseID:SPBC336.13c Length:180 Species:Schizosaccharomyces pombe

Alignment Length:132 Identity:45/133 (34%)
Similarity:72/133 (54%) Gaps:19/133 (14%)


  Fly    35 KGPSMEPTLHSD-NVLLTER--LSKHWRTYQPGDIVIAISPIKADQFICKRIVAVSGDQVLIQKP 96
            :|.||:|..:.: |:|..:|  |.|..:.|:.||:||..||...::.:.||::.|..|.:..:.|
pombe    43 EGRSMKPAFNPETNMLQRDRVLLWKWNKDYKRGDVVILRSPENPEELLVKRVLGVEYDIMKTRPP 107

  Fly    97 IPIEAEFSGNSDDKKKPVMVKDYVPRGHVWIEGDNKGNSSDSRYYGPIPVGLIRSRVLCRIWPIS 161
                          ||..:|.  ||.||||:|||.:.:|.||..:||:..|||.::|:..::|.|
pombe   108 --------------KKLSLVP--VPEGHVWVEGDEQFHSIDSNKFGPVSTGLITAKVIAILFPFS 156

  Fly   162 EA 163
            .|
pombe   157 RA 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9240NP_573054.2 sigpep_I_bact 30..159 CDD:274044 42/127 (33%)
S26_SPase_I 31..153 CDD:119398 41/121 (34%)
Peptidase_S24_S26 <81..145 CDD:299172 22/64 (34%)
SPBC336.13cNP_596133.1 sigpep_I_bact 36..156 CDD:274044 43/129 (33%)
S26_SPase_I 38..148 CDD:119398 41/121 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001147
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.