DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12708 and CG12496

DIOPT Version :9

Sequence 1:NP_001138199.1 Gene:CG12708 / 32502 FlyBaseID:FBgn0030666 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_570003.1 Gene:CG12496 / 31226 FlyBaseID:FBgn0040385 Length:353 Species:Drosophila melanogaster


Alignment Length:293 Identity:90/293 - (30%)
Similarity:134/293 - (45%) Gaps:74/293 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKWAVNQPRPSYLARDEVMATSSEAVGSSYSEFHALRGKLKRKSIGVAPGKEN-----QLTSTP 60
            ||||..:..|     .:|:.....:|   :..:...|:.:.:|:.......|||     ..||||
  Fly     1 MLKWTASAQR-----LNEIPVHDQDA---NQPQRRRLQRRQRRQRRATIANKENVPDTVGYTSTP 57

  Fly    61 LPASSLSLHARTPL----LKDLSNILATPPSGGASGANGATGGVTAVPLKFACTLPTFEAEYSPN 121
            :|.:.|   ..:||    |.|:.|:  ||.:...|.|......|     ::|.|||.|..:||||
  Fly    58 VPITRL---RNSPLVLAPLSDIRNV--TPEAVVRSQAPQRVQSV-----RYATTLPRFAEDYSPN 112

  Fly   122 AAIIP-GSLIALRGMGIPDSYFEKPRY----------LEQKPLPHP-----HPH------PAPPT 164
            .  :| |..:||||:...|.:..:|||          |:|:.|...     .|.      |.|||
  Fly   113 G--LPSGQHLALRGLAPLDPFLGQPRYIVGSGAGVNKLKQRRLDEDFVATLEPELQETAVPEPPT 175

  Fly   165 GEQNTL------SSSQMGDVTLERMIDAILESNRKVLPNARQQQHQHQHRQPRQ---HLRQRHRL 220
            .:....      :|:||||.||:|:|||||:|..|.  ||..:      ::||:   :||:|..:
  Fly   176 PKVEVRPSTPQPASTQMGDQTLDRLIDAILDSACKA--NASSK------KKPRRSTFNLRRRTLV 232

  Fly   221 RQQVLRSSHGHGHGPTQTPSPTYRPAFDPASDL 253
            :||:      ..:.|.:..||:|.|..||||||
  Fly   233 KQQM------ESNCPQEVLSPSYAPGDDPASDL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12708NP_001138199.1 DUF4799 38..400 CDD:292674 82/256 (32%)
CG12496NP_570003.1 DUF4799 54..>280 CDD:292674 78/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468826
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F87Z
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016800
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.