DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8119 and CG42526

DIOPT Version :8

Sequence 1:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001163401.1 Gene:CG42526 / 8674075 FlyBaseID:FBgn0260431 Length:245 Species:Drosophila melanogaster

Alignment Length:237 Identity:51/237 - (21%)
Similarity:93/237 - (39%) Gaps:73/237 - (30%)


  Fly    18 LLREIALRPSIWDSRIKFSLR--RPQIPIDWLDVSNAVGLGVDECKRRWKSLRNNY--------- 71
            |:..:....||::   |:..|  |.|.   |:.|:.|....|:.|:.||||||:.|         
  Fly     8 LIASVKRNVSIFE---KYHTRYDRKQA---WIAVAQACQKSVEYCQIRWKSLRDRYVRETQKPAA 66

  Fly    72 -RTKIHQGNAWSWPHSKQMEFVRDVFPPHKPKTPARCRVQVKKSKL--ILHPQQYL--------Q 125
             |:.|.:        .|:::|:|:           ..|::.|.::|  .|:..:.|        |
  Fly    67 TRSNIRK--------FKELDFLRE-----------HIRIRRKPNELCNTLNTNKTLVPGVTVDSQ 112

  Fly   126 SVASYSAFKKGG----------IEFEAEERLFLVTDEPAFDLDVDEEVTRLLGTDQWLWQTNLDF 180
            | |...|.::.|          ||::.||.....||..:.:. :.|:....:|::       |.:
  Fly   113 S-ADELALERNGITEFQPDEFIIEYKGEEEYLSETDNSSAEF-ISEDSACNIGSE-------LPY 168

  Fly   181 ILLPIFRAPPPSAMAKISNESNRHFLLSMVPMLRSLSDRSKE 222
            :..|.|.....|       ::...|:..|..:..:|.|:..|
  Fly   169 VTKPSFNGEGQS-------QTQAKFMSVMNLIESALKDKPAE 203

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8119NP_573050.1 MADF 17..97 CDD:214738 24/90 (27%)
BESS 201..234 CDD:281011 5/22 (23%)
CG42526NP_001163401.1 MADF 8..85 CDD:214738 24/101 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.