DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8119 and Adf1

DIOPT Version :8

Sequence 1:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster

Alignment Length:261 Identity:52/261 - (19%)
Similarity:101/261 - (38%) Gaps:51/261 - (19%)


  Fly    12 NLETN---HLLREIALRPSIWDS---RIKFSLRRPQIPIDWLDVSNAVGLGVDECKRRWKSLRNN 70
            |||..   :|:..:.|.|.|:|.   ..|..:|:.|   .|..::..:|:...:|.:||||||:.
  Fly     7 NLEQQFDLNLIEAVKLNPVIYDRSHYNYKHFVRKAQ---TWKQIAETLGVPEQKCTKRWKSLRDK 68

  Fly    71 YRTKIHQGNAWSWPHSKQMEFVRDVFPPHKPKTPARCRVQVKKSKLILHPQQYLQS-----VASY 130
            :..::.......|.:.|||:|:.|....::.....:|....:.:..:..|.|..|:     |..:
  Fly    69 FAREMKLCQESRWRYFKQMQFLVDSIRQYRESLLGKCANGSQSANQVADPSQQQQAQQQTVVDIF 133

  Fly   131 SAFKKGGIEFEAEERLFLVTDEPAFDLDVDEEVTRLLGTDQWLWQTNLDFILLPIFRAPP----- 190
            :....|.....|:    .:|......:..|.::...:|.||           .|.|..||     
  Fly   134 AQPFNGSATTSAQ----ALTHPHEITVTSDAQLATAVGKDQ-----------KPYFYEPPLKRER 183

  Fly   191 ----------------PSAMAKISNESNRHFLLSMVPMLRSLSDRSKERFRSWTRRVLREM-LIA 238
                            .:.:::..:..::.|.:.:..||.:|..|.|...:....:.|.:| |:|
  Fly   184 SEEEHSDNMLNTIKIFQNNVSQAVSAEDQSFGMVVTDMLNTLGVRQKAEAKVHIIKYLTDMQLLA 248

  Fly   239 E 239
            :
  Fly   249 Q 249

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8119NP_573050.1 MADF 17..97 CDD:214738 23/82 (28%)
BESS 201..234 CDD:281011 7/32 (22%)
Adf1NP_001260730.1 MADF 15..95 CDD:214738 23/82 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.