DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8119 and Coop

DIOPT Version :8

Sequence 1:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001260776.1 Gene:Coop / 35677 FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster

Alignment Length:343 Identity:67/343 - (19%)
Similarity:104/343 - (30%) Gaps:143/343 - (41%)


  Fly    13 LET-NHLLREIALRPSIWDSRIKFSLRRPQIPIDWLDVSNAVGLGVDECKRRWKSLRNNYRTKIH 76
            :|| ..|:..::.||.:|........:|..|...|.:|...|.|..|.|:.:|..||:|:| |::
  Fly    37 IETVKRLIAAVSRRPMLWLRNNANGQKRSDITPVWFEVGQDVNLPADICRIKWGHLRDNFR-KVY 100

  Fly    77 QGN------AWSWPHSKQMEFVRDVFPPHKPKTPARCRVQVKK--------SKLILHPQQY---- 123
            ..|      ..||.....|.|:.   |........:.|...||        :..:|.|.:|    
  Fly   101 IRNNLSNETPSSWRFYNDMRFME---PAVHENIMRQTRSSSKKHPPGHWTENNNVLGPDKYDSMP 162

  Fly   124 ----------------------LQSVASY-----------SAFKKGGIEFEAEERLFLVTDEPAF 155
                                  ...::|:           ..||....:.|.:|.     |:..|
  Fly   163 IVATEPICELSHSYDSELHQPSFSDISSFFEDRDCQPPENKRFKSEPSQREEDEE-----DDDDF 222

  Fly   156 D----------------------------LDVDEEVT---------------------------- 164
            |                            ||.|:|:.                            
  Fly   223 DEDAASENLEEERGNRADAASSGVFTIEVLDDDDEMEQAVTKTKANNTSHGGSSLKSEQEAKVFS 287

  Fly   165 -----------RLLGTDQWLWQTNLDFILLPIFRAPPPSAMAKISNESNRHFLLSMVPMLRSLSD 218
                       :.:.||.   .||.|           ||. ..:.:|::|.||||::|.|:.|..
  Fly   288 NSQSPTADLPFKYISTDV---ATNTD-----------PSG-GDLQDEADRMFLLSLMPFLQRLDS 337

  Fly   219 RSKERFRSWTRRVLREML 236
            |.:.|.|...:.||.|.|
  Fly   338 RRRLRVRQKLQNVLIEEL 355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8119NP_573050.1 MADF 17..97 CDD:214738 23/85 (27%)
BESS 201..234 CDD:281011 13/32 (41%)
CoopNP_001260776.1 MADF 42..124 CDD:214738 23/85 (27%)
BESS 320..353 CDD:281011 13/32 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.