DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8119 and CG45071

DIOPT Version :10

Sequence 1:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_730024.1 Gene:CG45071 / 19834908 FlyBaseID:FBgn0266441 Length:429 Species:Drosophila melanogaster


Alignment Length:246 Identity:52/246 - (21%)
Similarity:86/246 - (34%) Gaps:59/246 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KYPTNNLETNHLLREIALRPSIWDSRIKFSLRRPQIPIDWLDVSNAVGLGVDECKRRWKSLRNNY 71
            |..|..|.....:.:|..||:||:.  .|...:..:...|.::|.|..|.....|.:||.||:|:
  Fly     4 KKSTIVLNVEQFIHDIEERPAIWNR--NFHCNKAFLEQMWDELSGAHKLPKIVLKAKWKGLRDNF 66

  Fly    72 RT------KIHQGNAW--------SWPHSKQMEFVRDVFPPHKPKTPARCRVQVKKSKLILHPQQ 122
            |.      :...|:..        .|.|...:.|:.|......||..              ..|.
  Fly    67 RVEYKRIPRADNGDFMVDPATFESKWLHYYALLFLTDHMRHRLPKNE--------------QDQS 117

  Fly   123 YLQSVASYSAFKKGGIEFEAEERLFLVTDEPAFDLDVDEEVTRLLG--TDQWLWQTNLDFILLPI 185
            :..|..|... :|..:|.:....|.....:.  |.|.|||.....|  ::..:.:|      :| 
  Fly   118 FYFSQQSEDC-EKTVVEPDLTNGLIRRLQDS--DEDYDEEEMEADGEASEATMEET------MP- 172

  Fly   186 FRAPPPSA--MAKIS------------NESNRHFLLSMVPMLRSLSDRSKE 222
               .||:|  |.::|            .|:::|.|:....:...|.:..||
  Fly   173 ---TPPAAHQMNQVSTTPLATGALRAQEEAHQHALIKAGLLRAQLMELEKE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8119NP_573050.1 MADF 17..97 CDD:214738 22/93 (24%)
BESS 201..234 CDD:460758 5/22 (23%)
CG45071NP_730024.1 MADF 14..106 CDD:214738 22/93 (24%)
BESS 384..418 CDD:460758
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.