DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8119 and madf-9

DIOPT Version :8

Sequence 1:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_500389.2 Gene:madf-9 / 191167 WormBaseID:WBGene00022608 Length:333 Species:Caenorhabditis elegans

Alignment Length:231 Identity:42/231 - (18%)
Similarity:78/231 - (33%) Gaps:76/231 - (32%)


  Fly     9 PTNNLETNHLLREIALRPSIWDSRIK----FSLRRPQIPIDWLDVSNAVGLGVDECKRRWKSLRN 69
            |..|:   .|:.|:..||.::|...:    .|.|...    |.:::..:....:..|.|||:||:
 Worm    47 PVFNI---RLIAEVKARPFLYDQSDEGYNLLSWRNSA----WNEIAENLETTSEHVKTRWKTLRD 104

  Fly    70 NYRTKIHQ----GNAWSWPHSKQMEFVR--------------DVFPPHKPK-----TPARCRVQV 111
            .|:.:..:    ..|.||...:.::|::              ...|..||:     :|....:..
 Worm   105 RYKKEEKKERVSKKASSWVFQRPLKFIQAHLKDRHTDETDSNQSEPAVKPEPNGHVSPMEAAMSF 169

  Fly   112 KKSKLILHPQQYLQS-------------VASYSAFKKGGIEFEAEERLFLVTDEPAFDLDVDEEV 163
            .:::||........|             .:|.|:.|..|.:...|..  ::|..|          
 Worm   170 IENELIRTQDSSKSSGSTGEMESSSASTASSASSSKNTGTQEGGEAS--VITPPP---------- 222

  Fly   164 TRLLGTDQWLWQTNLDFILLPIFRAPPPSAMAKISN 199
                             :.:|:...|.|||.:..||
 Worm   223 -----------------LPIPMAVTPSPSATSSASN 241

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8119NP_573050.1 MADF 17..97 CDD:214738 19/101 (19%)
BESS 201..234 CDD:281011
madf-9NP_500389.2 MADF 52..136 CDD:214738 19/87 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.