DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8119 and madf-4

DIOPT Version :8

Sequence 1:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_505565.3 Gene:madf-4 / 179386 WormBaseID:WBGene00011575 Length:329 Species:Caenorhabditis elegans

Alignment Length:270 Identity:55/270 - (20%)
Similarity:91/270 - (33%) Gaps:108/270 - (40%)


  Fly    46 WLDVSNAVGLGVD----ECKRRWKSLRNNY---------RTKIHQGNAWSWPHSKQMEFVRDVFP 97
            |..:|  :.:|.|    |.:|:||.:|:.|         :..|.:.|.| :.:..:|.|: |.:.
 Worm    50 WKLIS--IEIGYDGQPVELERKWKHMRDKYVRLRKQDKQKAPIKKTNKW-YNYYHKMSFL-DPYV 110

  Fly    98 PHKPK------------------TPARCRVQVKKSKLILHPQQYLQS-VASY------SAFKKGG 137
            .|:.:                  |.....:.||:   :|.|:..|.| .|.|      |:....|
 Worm   111 EHRNRKRQKDYLNSNTPDFLDDDTAFLDGLSVKE---MLKPESLLTSNDAGYNSPHTTSSSSSSG 172

  Fly   138 IEFEAEERLFLVTDEPAFDLDVDEEVTRLL---------------------GTDQWLWQTN---- 177
            ......   ||  |.|..|::.|::...|:                     |.|.....||    
 Worm   173 SNNNGR---FL--DSPTIDIEDDKKNLALIYDKFVANQTENEKNHRFSNKHGKDLLFSTTNTLIE 232

  Fly   178 -----------------LDFILLPIFRAPPP-------SAMAKISNESNRH----FLLSMVPMLR 214
                             :...:||  .:|||       ..:..|.||.|..    |:.|:.   |
 Worm   233 KLATTSTAPSSSRKRKPIPVQILP--SSPPPQEKNTKIELLEDILNEPNEDQVSLFVRSIA---R 292

  Fly   215 SLSDRSKERF 224
            :|:|..:|:|
 Worm   293 TLNDLDREKF 302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8119NP_573050.1 MADF 17..97 CDD:214738 16/63 (25%)
BESS 201..234 CDD:281011 8/28 (29%)
madf-4NP_505565.3 MADF 22..111 CDD:214738 16/64 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.