DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8117 and MED26

DIOPT Version :9

Sequence 1:	NP_573049.2	Gene:	CG8117 / 32499	FlyBaseID:	FBgn0030663	Length:	162	Species:	Drosophila melanogaster
Sequence 2:	NP_004822.2	Gene:	MED26 / 9441	HGNCID:	2376	Length:	600	Species:	Homo sapiens

Alignment Length:	82	Identity:	24/82 - (29%)
Similarity:	33/82 - (40%)	Gaps:	14/82 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly    75 LLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQMAKVQGTKTDQFKCERCDKRNCSQL- 138
            |:.|..|.:|..:| .|:..||:         |.|.|:|...|.|.:..|...  .|...|..|
Human   531 LVPQSPPTDLPGLT-REVTQDDL---------DRIQASQWPGVNGCQDTQGNW--YDWTQCISLD 583

  Fly   139 -HIRDGDEPIITFVICD 154
             |..||...|:.:|..|
Human   584 PHGDDGRLNILPYVCLD 600

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8117	NP_573049.2	TFIIS_M	3..109	CDD:284835	9/33 (27%)
CG8117	NP_573049.2	Zn-ribbon	118..161	CDD:295390	11/39 (28%)
MED26	NP_004822.2	TFS2N	12..86	CDD:197766
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	99..330
		Med26_M	177..417	CDD:292322
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	348..402
		Med26_C	419..598	CDD:292321	22/78 (28%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	431..461
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1594
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810