DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and MED26

DIOPT Version :10

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_004822.2 Gene:MED26 / 9441 HGNCID:2376 Length:600 Species:Homo sapiens


Alignment Length:82 Identity:24/82 - (29%)
Similarity:33/82 - (40%) Gaps:14/82 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQMAKVQGTKTDQFKCERCDKRNCSQL- 138
            |:.|..|.:|..:| .|:..||:         |.|.|:|...|.|.:..|...  .|...|..| 
Human   531 LVPQSPPTDLPGLT-REVTQDDL---------DRIQASQWPGVNGCQDTQGNW--YDWTQCISLD 583

  Fly   139 -HIRDGDEPIITFVICD 154
             |..||...|:.:|..|
Human   584 PHGDDGRLNILPYVCLD 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFSII <4..161 CDD:273592 24/82 (29%)
MED26NP_004822.2 TFS2N 12..86 CDD:197766
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 99..330
Med26_M 177..417 CDD:464807
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..402
Med26_C 419..598 CDD:464806 22/78 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 431..461
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.