DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8117 and RPA12

Sequence 1:NP_573049.2 Gene:CG8117 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_012597.1 Gene:RPA12 SGDID:S000003824 Length:125 Species:Saccharomyces cerevisiae

Alignment Length:144 Identity:31/145 (21%)
Similarity:58/145 (40%) Gaps:40/145 (28%)


  Fly    26 CGDPDDMAAKLE--DAIYG---DLNGCKVKYKNRIRSRLANLRDPKNPELRQKFLLGQITPEELS 85
            |||      .||  :|:.|   :.:.||..|.   :|:.:||:              .:|     
Yeast    13 CGD------LLENPNAVLGSNVECSQCKAIYP---KSQFSNLK--------------VVT----- 49

  Fly    86 KMTPEEMASDDMKQMRQKYVQDSINAAQMAKVQGTKTDQFKCERC--DKRNCSQLHIRDGDEPII 148
              |..:.|.....:.::..|:.|:...::   :...|.:.||.:|  ::.|...|.:|..||...
Yeast    50 --TTADDAFPSSLRAKKSVVKTSLKKNEL---KDGATIKEKCPQCGNEEMNYHTLQLRSADEGAT 109

  Fly   149 TFVICDECGNRWKS 162
            .|..|..||.::::
Yeast   110 VFYTCTSCGYKFRT 123

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 18/88 (20%)
Zn-ribbon 118..161 CDD:295390 13/45 (29%)
RPA12NP_012597.1 RPB9 6..124 CDD:224510 31/145 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.