DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8117 and DST1

Sequence 1:NP_573049.2 Gene:CG8117 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_011472.1 Gene:DST1 SGDID:S000003011 Length:309 Species:Saccharomyces cerevisiae

Alignment Length:164 Identity:53/165 (32%)
Similarity:82/165 (50%) Gaps:13/165 (8%)


  Fly     8 KCREMLATAL-----KSGNMPPGCGDPDDMAAKLEDAIYGDLNGC---KVKYKNRIRSRLANLRD 64
            |.|:.:..||     |....||   ......||..::....:|.|   :..||.|.|...:|:..
Yeast   147 KLRDQVLKALYDVLAKESEHPP---QSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVIS 208

  Fly    65 PKNPELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQMAKVQGTKTDQFKCER 129
            ..||:|:.|...|.||||.|:....:::|...:||..::..:.::..||.|.::.:.||:|.|.:
Yeast   209 KNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGK 273

  Fly   130 CDKRNCS--QLHIRDGDEPIITFVICDECGNRWK 161
            |.::..|  ||..|..|||:.||..|:.||||||
Yeast   274 CKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 29/109 (27%)
Zn-ribbon 118..161 CDD:295390 20/45 (44%)
DST1NP_011472.1 TFSII 3..309 CDD:273592 53/165 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112472761
eggNOG 1 0.900 E1_COG1594
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I1244
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000678
OrthoInspector 1 1.000 T634540
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11477
Phylome 1 0.910 0.778 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2312
TreeFam 1 0.960
109.880

Return to query results.
Submit another query.