DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8117 and TFIIS

Sequence 1:NP_573049.2 Gene:CG8117 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_181390.1 Gene:TFIIS AraportID:AT2G38560 Length:378 Species:Arabidopsis thaliana

Alignment Length:171 Identity:60/172 (35%)
Similarity:88/172 (51%) Gaps:18/172 (10%)


  Fly     5 IRIKCREMLATAL------------KSGNMPPGCGDPDDMAAKLEDAIYGDLNGCKVKYKNRIRS 57
            :|.|.||:|..||            :|.|    ..||..:|..:|..::..|.......|.:.||
plant   210 VRDKIRELLVEALCRVAGEADDYERESVN----ASDPLRVAVSVESLMFEKLGRSTGAQKLKYRS 270

  Fly    58 RLANLRDPKNPELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQMAKVQGTKT 122
            .:.||||..||:||::.|.|:|:||:|..::.|:||||..||...:..:.::...:........|
plant   271 IMFNLRDSNNPDLRRRVLTGEISPEKLITLSAEDMASDKRKQENNQIKEKALFDCERGLAAKAST 335

  Fly   123 DQFKCERCDKRNCS--QLHIRDGDEPIITFVICDECGNRWK 161
            |||||.||.:|.|:  |:..|..|||:.|:|.|..|.|.||
plant   336 DQFKCGRCGQRKCTYYQMQTRSADEPMTTYVTCVNCDNHWK 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 38/116 (33%)
Zn-ribbon 118..161 CDD:295390 21/45 (47%)
TFIISNP_181390.1 TFSII 21..378 CDD:273592 60/172 (35%)
TFS2N 21..88 CDD:197766
TFIIS_M 208..322 CDD:284835 38/116 (33%)
Zn-ribbon_TFIIS 332..377 CDD:259796 22/46 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I1780
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1579101at2759
OrthoInspector 1 1.000 T32307
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11477
Phylome 1 0.910 0.854 Consistency score
66.070

Return to query results.
Submit another query.