DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and tceanc2

DIOPT Version :10

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:XP_073776097.1 Gene:tceanc2 / 567698 ZFINID:ZDB-GENE-070705-486 Length:248 Species:Danio rerio


Alignment Length:54 Identity:13/54 - (24%)
Similarity:25/54 - (46%) Gaps:6/54 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YKNRIRSRLANLRDPKNPELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKY 104
            |:..:|:.:..|:  ..||||.:..: .:.|:...   ..|:.|.|..:..|:|
Zfish   171 YRRTVRALVFALK--HKPELRVQLPM-TLLPDSFG---VSEICSKDTCETLQEY 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFSII <4..161 CDD:273592 13/54 (24%)
tceanc2XP_073776097.1 None

Return to query results.
Submit another query.