DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8117 and Polr1H

DIOPT Version :10

Sequence 1:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_524439.1 Gene:Polr1H / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster


Alignment Length:33 Identity:12/33 - (36%)
Similarity:17/33 - (51%) Gaps:2/33 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 KCERC--DKRNCSQLHIRDGDEPIITFVICDEC 156
            ||.:|  ||.:.:.|.:|..||....|..|.:|
  Fly    80 KCPKCNHDKMSYATLQLRSADEGQTVFFTCLKC 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFSII <4..161 CDD:273592 12/33 (36%)
Polr1HNP_524439.1 RPB9 10..115 CDD:441202 12/33 (36%)
Zn-ribbon_RPA12 73..119 CDD:259792 12/33 (36%)

Return to query results.
Submit another query.