DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8117 and pps

Sequence 1:NP_573049.2 Gene:CG8117 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001247075.1 Gene:pps FlyBaseID:FBgn0082831 Length:2018 Species:Drosophila melanogaster

Alignment Length:162 Identity:43/163 (26%)
Similarity:67/163 (41%) Gaps:28/163 (17%)


  Fly     5 IRIKCREMLATALKSGN-MPPGCGDP----------DDMAAKLEDAIYGDL-NGCKVKYKNRIRS 57
            ||...||.|...:|... .....|.|          |.....:|..::... .....|||.:.||
  Fly  1280 IRRSLREQLLARIKEAQAAEENSGQPTTQWPTVLEVDQFVKNVELEMFNSFGRDVGAKYKAKYRS 1344

  Fly    58 RLANLRDPKNPELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQMAKVQGTKT 122
            .:.|::|.||..|.:|....|:.|.:|.:||||::||.::.:.|::.     |..|:        
  Fly  1345 LMFNIKDRKNRTLFEKICAKQVEPRQLVRMTPEQLASQELAKWREEE-----NRHQL
-------- 1396

  Fly   123 DQFKCERCDKRNCSQLHI---RDGDEPIITFV 151
            |..|....|...|:|.::   ..|:|.|.|.|
  Fly  1397 DMIKKSELDLLACAQNYVVKTHKGEEVIATKV 1428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 31/116 (27%)
Zn-ribbon 118..161 CDD:295390 10/38 (26%)
ppsNP_001247075.1 TNG2 <827..965 CDD:227367
PHD_PHF3_like 914..963 CDD:277027
BRK 1142..1186 CDD:197800
TFIIS_M 1274..1396 CDD:284835 33/121 (27%)
SPOC 1623..1729 CDD:285043
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11477
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.