DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8117 and tcea1

Sequence 1:NP_573049.2 Gene:CG8117 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_956288.1 Gene:tcea1 ZFINID:ZDB-GENE-030131-8049 Length:309 Species:Danio rerio

Alignment Length:163 Identity:77/164 (47%)
Similarity:115/164 (70%) Gaps:3/164 (2%)


  Fly     2 SMEIRIKCREMLATALKSGNMPPGCG-DPDDMAAKLEDAIYGDLNGCKVKYKNRIRSRLANLRDP 65
            |..:||||||||:.||::|:.....| |.|::.|::|:.|:.:.....:|||||:|||::||:|.
Zfish   145 SDSVRIKCREMLSNALQTGDDYITIGSDCDELGAQIEECIFLEFKNTDMKYKNRVRSRISNLKDA 209

  Fly    66 KNPELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQMAKVQGTKTDQFKCERC 130
            |||.||:..|.|.::|:.::|||.||||||::|:||:...:::|...|:|...||:||.|.|.:|
Zfish   210 KNPNLRRNVLCGNVSPDRIAKMTAEEMASDELKEMRKNLTKEAIRDHQVATSGGTQTDLFTCGKC 274

  Fly   131 DKRNC--SQLHIRDGDEPIITFVICDECGNRWK 161
            .|:.|  :|:..|..|||:.|||.|:|||||||
Zfish   275 KKKKCTYTQVQTRSADEPMTTFVFCNECGNRWK 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 48/107 (45%)
Zn-ribbon 118..161 CDD:295390 24/45 (53%)
tcea1NP_956288.1 TFIIS_I 6..82 CDD:238107
TFSII 7..309 CDD:273592 77/164 (47%)
TFIIS_M 146..253 CDD:284835 48/107 (45%)
Zn-ribbon_TFIIS 262..308 CDD:259796 25/47 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112497451
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1579101at2759
OrthoFinder 1 1.000 FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11477
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2312
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.980

Return to query results.
Submit another query.