DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8117 and AT2G42725

Sequence 1:NP_573049.2 Gene:CG8117 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001324130.1 Gene:AT2G42725 AraportID:AT2G42725 Length:247 Species:Arabidopsis thaliana

Alignment Length:116 Identity:42/117 (36%)
Similarity:57/117 (49%) Gaps:25/117 (21%)


  Fly     6 RIKCREMLATAL----------KSGNMPPGCGDPDDMAAKLEDAIYGDLNGC-----KVKYKNRI 55
            |.|.||:|.|:|          :.......| ||..:|..:|.|::..| ||     |.||    
plant   117 RDKVREILQTSLVKVASEIVDTEMKTRVTAC-DPSVVAVSVESAMFEKL-GCFMGPHKAKY---- 175

  Fly    56 RSRLANLRDPKNPELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKYVQ 106
            ||.|.|:.|..||:||:|.|:|:|..|.|..|..:||.|:.:    ||.||
plant   176 RSILFNMGDSNNPDLRRKVLIGEINGERLVTMERQEMGSEKI----QKEVQ 222

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 42/117 (36%)
Zn-ribbon 118..161 CDD:295390
AT2G42725NP_001324130.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1579101at2759
OrthoInspector 1 1.000 T32307
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11477
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.