DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8117 and Tcea3

Sequence 1:NP_573049.2 Gene:CG8117 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster
Sequence 2:XP_006538773.1 Gene:Tcea3 MGIID:1196908 Length:385 Species:Mus musculus

Alignment Length:160 Identity:78/161 (48%)
Similarity:114/161 (71%) Gaps:3/161 (2%)


  Fly     5 IRIKCREMLATALKSGNMPPGCG-DPDDMAAKLEDAIYGDLNGCKVKYKNRIRSRLANLRDPKNP 68
            :|.||.|||:.|||:.:.....| :.|.:|:::||.||.:|....:||:||:|||::||:||:||
Mouse   224 VRDKCVEMLSAALKAEDNFKDYGVNCDKLASEIEDHIYQELKSTDMKYRNRVRSRISNLKDPRNP 288

  Fly    69 ELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQMAKVQGTKTDQFKCERCDKR 133
            .||:..|.|.|:||.::|||.||||||:::::|....|::|...||||..||.||..:|.:|.|:
Mouse   289 GLRRNVLSGAISPELIAKMTAEEMASDELRELRNAMTQEAIREHQMAKTGGTTTDLLRCSKCKKK 353

  Fly   134 NC--SQLHIRDGDEPIITFVICDECGNRWK 161
            ||  :|:..|..|||:.|||:|:|||||||
Mouse   354 NCTYNQVQTRSADEPMTTFVLCNECGNRWK 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 48/105 (46%)
Zn-ribbon 118..161 CDD:295390 24/45 (53%)
Tcea3XP_006538773.1 TFIIS_I 4..93 CDD:238107
TFSII 5..385 CDD:273592 78/161 (48%)
TFS2M 222..323 CDD:128786 47/99 (47%)
Zn-ribbon_TFIIS 338..384 CDD:259796 25/47 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112490366
eggNOG 1 0.900 E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1579101at2759
OrthoFinder 1 1.000 FOG0000678
OrthoInspector 1 1.000 T617000
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11477
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2312
TreeFam 1 0.960
98.840

Return to query results.
Submit another query.