DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9220 and b4galnt3a

Sequence 1:NP_001285280.1 Gene:CG9220 FlyBaseID:FBgn0030662 Length:832 Species:Drosophila melanogaster
Sequence 2:XP_021327218.1 Gene:b4galnt3a ZFINID:ZDB-GENE-060503-519 Length:726 Species:Danio rerio

Alignment Length:677 Identity:139/678 (21%)
Similarity:250/678 (37%) Gaps:183/678 (27%)


  Fly   128 PQKKSFMMLYYMYEHYIDRFEW-FIRADDD-------VYMEPDKLE------------------- 165
            ||..|:.:..:.:.|..:..|: |..|.||       :...|.||:                   
Zfish   126 PQGNSYGLRIFGFLHPAETNEYIFAVASDDNSEFWLSLNKSPKKLQLLAYVGETGNEWTAPGEYW 190

  Fly   166 RFLRSIDSSKPQFIGQAGKGNSE-----EFGLLSLEFDENFCMGGPGV-ILSSETLRRVAPHIPS 224
            :|...|  |||..:.:..|...|     ..|:..||...:...|.... :::||.|         
Zfish   191 KFATQI--SKPVLLVKDRKYFFEVLLKQNTGMDHLEIAWSLNQGNSTFSVITSEYL--------- 244

  Fly   225 CLKNLYSTHEDVEVGRCVQKFAGIPCTWNYEMQYILRHNSSGRNAYTGKLKRKEIHNAITLHP-- 287
               :||.....:.:|.                   :.|....:.:|...|:    .|.::||.  
Zfish   245 ---SLYKDESSLLMGD-------------------IEHVPQTKASYDRFLE----PNPLSLHQRE 283

  Fly   288 -IKQAPLMYRLHSYVQGLKAEEMRQESLLLHRDIKRMAKYLEVPDESTYMLPSVSPESDSTKRH- 350
             |::.|   |.|.|     ..:|.:||.|  :|:     :.|...:.:|:|          |.| 
Zfish   284 IIREDP---RDHIY-----KYKMLEESFL--KDL-----FPECDYKPSYVL----------KEHI 323

  Fly   351 --FQDHNILGISPELNKFVPASTDDLLDWSFIARSLYSASSANPKQKIDSAMREGLEDAITEVME 413
              :|...::..|..........|:|..|.....|.       :|....|    :|||..:|||.:
Zfish   324 GRYQGVYLVQFSSVYPNDYTRQTNDQNDGMCFYRQ-------DPSFLAD----KGLEGYLTEVED 377

  Fly   414 -NINNYSRQRGRVIEFRELLYGYHRLDALHGQDMIL------DLLLIYKKYRGKKMTVPVRRHLY 471
             ::.|..:..|   .|...:|..:.|:|...|..|:      ...::..:.:...:.....:.|:
Zfish   378 PDVQNTYKGEG---PFWHRVYDVNPLNAASKQTTIVANSCRTSGNIVMSESQALPIVTAFLKALH 439

  Fly   472 VQRAFTGI-------FVKEVDEDF---YNVTLQ------QSLLGSLFQNGMARLSSHFTMPSGLL 520
            .:....|.       .||..|:|.   |.|.|:      |::|.|.:.......||   .|:.|.
Zfish   440 SREDTQGYSLLRVVNVVKREDKDLGSRYLVELELVDPQGQTVLVSRYIYAQDENSS---KPALLC 501

  Fly   521 SP------TQDKIVFVLPIAGRLGTFERFLRTYERVC-VRGEQHCDLLVVIFGSPD-ELGDHLQL 577
            ||      ....:..::.:..:.....:|:|..|::. ..|:::.::::|.:.|.| .:...|::
Zfish   502 SPKAFNWNPSATVHIIVAVKDQARWIIQFIREMEKIYQATGDKNFNVIIVDYNSSDINIEKRLEM 566

  Fly   578 LHDLHARHVYQQVNWIQRSSAFSRGVALDVAARSSYIRQEDIILFI-DVDMVFEVETLQRVRMHT 641
            . .|.:..:.:.....:||.....|:.|        :..|..|||: |:.:.:.|..:..:|.|.
Zfish   567 A-KLPSYKLKKMGGNFERSGGLQAGIDL--------VEDEHSILFLCDLHLYYPVTIINSIRKHC 622

  Fly   642 QRGKQVYLPIVFSQYDPQRRSGDAGGSEDEGETPRIDDERGYFRQFGFGICAIYKSDILDEDING 706
            ..||.||.|:|...              |.|.:||..:  |::...|:|:..|||||:  :.|.|
Zfish   623 VEGKMVYAPVVMRL--------------DCGASPRTPN--GFWEIAGYGLMGIYKSDM--DRIGG 669

  Fly   707 FD----KDITGWGLEDVKFLEKIVRVG 729
            .:    ||  .||.||.:.|::::..|
Zfish   670 MNTVEFKD--KWGGEDWELLDRVLGNG 694

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9220NP_001285280.1 Galactosyl_T 71..>251 CDD:304462 29/156 (19%)
CHGN 221..799 CDD:283361 113/552 (20%)
b4galnt3aXP_021327218.1 PA14 <123..232 CDD:324285 22/108 (20%)
Glyco_tranf_GTA_type <430..710 CDD:325014 67/298 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3588
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.