DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9220 and CHSY3

Sequence 1:NP_001285280.1 Gene:CG9220 FlyBaseID:FBgn0030662 Length:832 Species:Drosophila melanogaster
Sequence 2:NP_787052.3 Gene:CHSY3 HGNCID:24293 Length:882 Species:Homo sapiens

Alignment Length:759 Identity:308/760 (41%)
Similarity:449/760 (59%) Gaps:81/760 (11%)


  Fly    68 RNLVFVGVMTAKSFLEGRARAVYDTWGKEVPGRMAFFSSE-----GSYSDDLPVVGLKNVDDRYP 127
            |:.::||||||:.:|..||.|...||.:.:|||:.||||:     |.....|||:.|..|||.||
Human   170 RDFLYVGVMTAQKYLGSRALAAQRTWARFIPGRVEFFSSQQPPNAGQPPPPLPVIALPGVDDSYP 234

  Fly   128 PQKKSFMMLYYMYEHYIDRFEWFIRADDDVYMEPDKLERFLRSIDSSKPQFIGQAGKGNSEEFGL 192
            ||||||||:.||::||:|::|||:|||||||::.||||.||||::||||.::||.|.||.||.|.
Human   235 PQKKSFMMIKYMHDHYLDKYEWFMRADDDVYIKGDKLEEFLRSLNSSKPLYLGQTGLGNIEELGK 299

  Fly   193 LSLEFDENFCMGGPGVILSSETLRRVAPHIPSCLKNLYSTHEDVEVGRCVQKFAGIPCTWNYEMQ 257
            |.||..|||||||||:|.|.|.|||:.|||..||:.:|:|||||||||||::|.|..|.|:||||
Human   300 LGLEPGENFCMGGPGMIFSREVLRRMVPHIGECLREMYTTHEDVEVGRCVRRFGGTQCVWSYEMQ 364

  Fly   258 YILRHN-SSGRNAYTGKLKRKEIHNAITLHPIKQAPLMYRLHSYVQGLKAEEMRQESLLLHRDIK 321
            .:...| ...|..|...|...:||.||||||.|:....||||:|:...|..|:|..::.|||:..
Human   365 QLFHENYEHNRKGYIQDLHNSKIHAAITLHPNKRPAYQYRLHNYMLSRKISELRYRTIQLHRESA 429

  Fly   322 RMAKYLEVPDESTYMLPSVSPESDSTKRHFQDHNILGISPELNKFVPASTDDLLDWSFI-ARSLY 385
            .|:|....         .||.|...          ||:.|..|.|.|...:::::|.|: .:.||
Human   430 LMSKLSNT---------EVSKEDQQ----------LGVIPSFNHFQPRERNEVIEWEFLTGKLLY 475

  Fly   386 SAS-SANPKQKIDSAMREGLEDAITEVMENINNYSRQRGRVIEFRELLYGYHRLDALHGQDMILD 449
            ||: :..|:|.:.|.:|..|:|.:.:|||.||..::.|||:|:|:|:.|||.|::.:||.:.|||
Human   476 SAAENQPPRQSLSSILRTALDDTVLQVMEMINENAKSRGRLIDFKEIQYGYRRVNPMHGVEYILD 540

  Fly   450 LLLIYKKYRGKKMTVPVRRHLYVQRAFTGIFVKEVDEDFYNVTLQQSLLG-----SLFQNGMARL 509
            |||:||:::|:|:|||||||.|:|:.|:..|.:|.:|...| :|.:|:..     |...|.:..|
Human   541 LLLLYKRHKGRKLTVPVRRHAYLQQLFSKPFFRETEELDVN-SLVESINSETQSFSFISNSLKIL 604

  Fly   510 SSHFTMPSGLLSPTQDKIVFVLPIAGRLGTFERFLRTYERVCVRGEQHCDLLVVIFG--SPDELG 572
            || |.....:....:.|:..::|:.||...|.||:..:|.:|:..:|:..|::::|.  |..:..
Human   605 SS-FQGAKEMGGHNEKKVHILVPLIGRYDIFLRFMENFENMCLIPKQNVKLVIILFSRDSGQDSS 668

  Fly   573 DHLQLLHDLHARHVYQQVNWIQRSSAFSRGVALDVAARSSYIRQEDIILFIDVDMVFEVETLQRV 637
            .|::|:.....::...::..|.....||||:.|::|  |:....:.::||.|||::|..:.|||.
Human   669 KHIELIKGYQNKYPKAEMTLIPMKGEFSRGLGLEMA--SAQFDNDTLLLFCDVDLIFREDFLQRC 731

  Fly   638 RMHTQRGKQVYLPIVFSQYDPQRRSGDAGGSEDEGETPRIDD------ERGYFRQFGFGICAIYK 696
            |.:|.:|:|||.||:||||||:..:|.         .|..||      :.|::|.:|:||..|||
Human   732 RDNTIQGQQVYYPIIFSQYDPKVTNGG---------NPPTDDYFIFSKKTGFWRDYGYGITCIYK 787

  Fly   697 SDILDEDINGFDKDITGWGLEDVKFLEKIVRVGTRQRGFLANTAELAMDYNEAAEQWRRLSVFRA 761
            ||:|  ...|||..|.|||||||....|::..|.|.                          ||:
Human   788 SDLL--GAGGFDTSIQGWGLEDVDLYNKVILSGLRP--------------------------FRS 824

  Fly   762 PDPTLVHIYHDISCDVQLDAPQYNMCLGTKANSLGSTRLMEQLF 805
            .:..:|||:|.:.||..||..||.||||:||::..||..:.:|:
Human   825 QEVGVVHIFHPVHCDPNLDPKQYKMCLGSKASTFASTMQLAELW 868

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9220NP_001285280.1 Galactosyl_T 71..>251 CDD:304462 110/185 (59%)
CHGN 221..799 CDD:283361 215/594 (36%)
CHSY3NP_787052.3 Galactosyl_T 173..398 CDD:328824 128/225 (57%)
CHGN 328..864 CDD:310350 215/596 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87638127
eggNOG 1 0.900 E1_KOG3588
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 601 1.000 Inparanoid score I938
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D211685at33208
OrthoFinder 1 1.000 FOG0002811
OrthoInspector 1 1.000 T609259
orthoMCL 1 0.900 OOG5_132390
Panther 1 1.100 LDO PTHR12369
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3461
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.