DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9220 and B4galnt3

Sequence 1:NP_001285280.1 Gene:CG9220 FlyBaseID:FBgn0030662 Length:832 Species:Drosophila melanogaster
Sequence 2:NP_942585.1 Gene:B4galnt3 MGIID:3041155 Length:986 Species:Mus musculus

Alignment Length:793 Identity:165/794 (21%)
Similarity:285/794 (36%) Gaps:247/794 (31%)


  Fly    49 KTPADIIGL-----RDE----DTIQNSQRNLVFVGVMTAKSFLEGRARAVYDTWGKEVPGRMAFF 104
            :|.|..:|.     |||    |.::...|:.:|...:.|||.|    |.|.    .:.|.:.::.
Mouse   299 QTAASHVGSSNTPPRDEQPPADMLRPDPRDTLFRVPLIAKSHL----RHVL----PDCPYKPSYL 355

  Fly   105 SSEGSYSDDLPVVGLKNVDDRYPPQKKSFMMLYYMYEHYIDRFEWFIRADDDVYME----PDKLE 165
                  .|.||:       .||  |...|:.|.::|.:...|.......:...|.|    .|: .
Mouse   356 ------VDGLPL-------QRY--QGLRFVHLSFVYPNDYTRLSHMETHNKCFYQESAYDQDR-S 404

  Fly   166 RFLRSIDSSKPQFIGQAGKGNSEEFGLLSLEFDENFCMGGPGVILSSETLRRVAPHIPSCLKNLY 230
            .|...|...||:..|.......|: |||.....|:                 |...||       
Mouse   405 SFQEYIKMDKPEKHGPEQPAGLED-GLLEESQYED-----------------VPEEIP------- 444

  Fly   231 STHEDVEVGRCVQK-----FAGIPCTWNYEMQYILRHNSSGRNAYTGKLKRKEIHNAITLHPIKQ 290
             |.:|...|...:|     ..|:..| :|.::.:|..:.||..|...|      .|:.|..|.:.
Mouse   445 -TSQDQNTGIQGRKQKTISTPGLGVT-DYHLRKLLARSQSGPVAPLSK------QNSTTAFPTRT 501

  Fly   291 A----------------------------PLMYRLH----------------SYVQGLKAEEMR- 310
            :                            ||:.|..                :.|:...||:.| 
Mouse   502 SNIPVQRPEKSPVPSRDLSHSDQGARRNLPLIQRARPTGDRPGKTLEQSQWLNQVESFIAEQRRG 566

  Fly   311 --------------QESLLLHRDIKRMAKYLEVPDESTYMLPSVSPESDSTKRHFQDHNILGISP 361
                          :|.:::..|.:.     ||.:|.    .....|.|.:              
Mouse   567 DRIEPPTPSRGWRPEEDVVIAADQEG-----EVEEEE----EGEDEEEDMS-------------- 608

  Fly   362 ELNKFVPASTDDLLDW--SFIARSL-YSA-----------SSAN---PKQKIDSAMREGLEDAIT 409
            |:.::|| ..|.:::|  :|.|::| :.|           :|.|   |:|       |.||  :|
Mouse   609 EVFEYVP-MFDPVVNWGQTFSAQNLDFQALRTDWIDLNCNTSGNLLLPEQ-------EALE--VT 663

  Fly   410 EV-MENINNYSRQRGRVIEFRELLYGYHRLDALHGQDMILDLLLIYKKYRGKKMTVPVRRHLYVQ 473
            .| :..::  .|.||| .:.:.::....|.|.|.|....|:|.|:    .|:::   ||...||.
Mouse   664 RVFLRKLS--QRTRGR-YQLQRIVNVEKRQDRLRGGRYFLELELL----DGQRL---VRLSEYVS 718

  Fly   474 -RAFTGIFVKEVDEDFYNVTLQQSLLGSLF------------QNGMARLSSHFTMPSGLLSPTQD 525
             |.:.|     .|......|..::|.|.::            |:...:|    ..|.|.....:.
Mouse   719 TRGWRG-----GDHPGREDTEARNLQGLVWSPRNRHRHVLNAQDPEPKL----CWPQGFSWNHRA 774

  Fly   526 KIVFVLPIAGRLGTFERFLRTYERVC-VRGEQHCDLLVVIFGSPDELGDHLQLLHDLHARHVYQQ 589
            .:.|::|:..:....::|:|..|.:. |.|:.|..:::..:.|.| :...:.|     .|...:.
Mouse   775 VVHFIVPVKNQARWVQQFIRDMESLSQVTGDAHFSIIITDYSSED-MDVEMAL-----KRSRLRS 833

  Fly   590 VNWIQRSSAFSRGVALDVAARSSYIRQEDIILFI-DVDMVFEVETLQRVRMHTQRGKQVYLPIVF 653
            ..:::.|..|.|...|.  |....::....|:|: |:.:.|....:..:|.|...||..:.|:|.
Mouse   834 YQYLKLSGNFERSAGLQ--AGIDLVKDPHSIIFLCDLHIHFPAGIIDTIRKHCVEGKMAFAPMVM 896

  Fly   654 SQYDPQRRSGDAGGSEDEGETPRIDDERGYFRQFGFGICAIYKSDILDEDINGFD-KDITG-WGL 716
            ..:.              |.||:..:  ||:...|||:..|||||:  :.|.|.: |:... ||.
Mouse   897 RLHC--------------GATPQWPE--GYWEVNGFGLLGIYKSDL--DKIGGMNTKEFRDRWGG 943

  Fly   717 EDVKFLEKIVRVG 729
            ||.:.|::|::.|
Mouse   944 EDWELLDRILQAG 956

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9220NP_001285280.1 Galactosyl_T 71..>251 CDD:304462 39/189 (21%)
CHGN 221..799 CDD:283361 125/609 (21%)
B4galnt3NP_942585.1 PA14 143..277 CDD:284994
Glyco_tranf_GTA_type <776..972 CDD:299700 50/208 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3588
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.